spacer

EBI Dbfetch

ID   BC005590; SV 1; linear; mRNA; STD; MUS; 699 BP.
XX
AC   BC005590;
XX
DT   05-APR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Mus musculus S100 calcium binding protein A1, mRNA (cDNA clone MGC:11425
DE   IMAGE:3964547), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-699
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-699
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-APR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 39aedc1416c297bb4544e4172a6915cd.
DR   Ensembl-Gn; ENSMUSG00000044080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060738; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 17 Row: e Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981511.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..699
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:11425 IMAGE:3964547"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..699
FT                   /gene="S100a1"
FT                   /note="synonyms: S100, S100a"
FT   misc_difference 1..13
FT                   /gene="S100a1"
FT                   /note="13 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 80^81
FT                   /gene="S100a1"
FT                   /note="2 bases in the mouse genome, GT, are not found in
FT                   cDNA."
FT   CDS             216..500
FT                   /codon_start=1
FT                   /gene="S100a1"
FT                   /product="S100 calcium binding protein A1"
FT                   /db_xref="GOA:Q91V77"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028486"
FT                   /db_xref="MGI:MGI:1338917"
FT                   /db_xref="UniProtKB/TrEMBL:Q91V77"
FT                   /protein_id="AAH05590.1"
FT                   /translation="MGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGF
FT                   LDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS"
FT   misc_difference 685..699
FT                   /gene="S100a1"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 699 BP; 169 A; 183 C; 189 G; 158 T; 0 other;
     cccacgcgtc cggacagagg gcgcctctgt ccactcctgg cccttagccc tttgggtgtc        60
     gtttgtgaag gggtggagcc tggggaggag gtcggtaggg aaagacgact aaaagacagg       120
     tctcctcaca ccggtccagt ggccacattt gcagcgtgcc cttctgtcga gaatctgttc       180
     cgacgtcagg ccgaggccaa ccgtgtgctg ctgaaatggg ctctgagctg gagagtgcca       240
     tggagaccct catcaatgtg ttccatgccc attcgggcaa ggaaggggac aaatataagc       300
     tgagcaagaa agaactgaaa gacctgctac aaactgaact ttctggcttc ctggatgtcc       360
     agaaggatgc agatgctgtg gacaaggtaa tgaaggaact ggatgaaaac ggagatgggg       420
     aagtggactt caaggagtat gttgtgctgg tggctgctct cacagtggct tgtaacaact       480
     tcttctggga gaccagttga gcacagtctg tgagcagtgc ccttcctctc ccacttgtca       540
     agatttcccc tttagcgtgc ttgctcctca ccccacctgt acctccctat gtccccatcc       600
     ttgcccagtc tcgacgtgca ccaagggcac aagagtggca gtccagatct gccacttgtt       660
     ttaataaagc cttctctctc accaaaaaaa aaaaaaaaa                              699
//


spacer
spacer