Dbfetch

ID   BC005490; SV 1; linear; mRNA; STD; MUS; 2541 BP.
XX
AC   BC005490;
XX
DT   04-APR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus amyloid beta (A4) precursor protein, mRNA (cDNA clone
DE   IMAGE:3486773), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2541
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2541
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (27-MAR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; f3168015a461aa451e310fdea73f2946.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 7 Row: l Column: 17.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2541
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="IMAGE:3486773"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..2541
FT                   /gene="App"
FT                   /note="synonyms: betaAPP, Abeta, appican"
FT   CDS             <1..1826
FT                   /codon_start=3
FT                   /gene="App"
FT                   /product="App protein"
FT                   /db_xref="GOA:P12023"
FT                   /db_xref="InterPro:IPR002223"
FT                   /db_xref="InterPro:IPR008154"
FT                   /db_xref="InterPro:IPR008155"
FT                   /db_xref="InterPro:IPR011178"
FT                   /db_xref="InterPro:IPR013803"
FT                   /db_xref="InterPro:IPR015849"
FT                   /db_xref="InterPro:IPR019543"
FT                   /db_xref="InterPro:IPR019744"
FT                   /db_xref="InterPro:IPR019745"
FT                   /db_xref="InterPro:IPR020901"
FT                   /db_xref="InterPro:IPR024329"
FT                   /db_xref="InterPro:IPR028866"
FT                   /db_xref="MGI:MGI:88059"
FT                   /db_xref="PDB:2ROZ"
FT                   /db_xref="PDB:2YSZ"
FT                   /db_xref="PDB:2YT0"
FT                   /db_xref="PDB:2YT1"
FT                   /db_xref="PDB:4YN0"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12023"
FT                   /protein_id="AAH05490.1"
FT                   /translation="NLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDV
FT                   WWGGADTDYADGGEDKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATE
FT                   RTTSTATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCVPFFYGGCGG
FT                   NRNNFDTEEYCMAVCGSVSTQSLLKTTSEPLPQDPDKLPTTAASTPDAVDKYLETPGDE
FT                   NEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQ
FT                   EAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQK
FT                   DRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEV
FT                   DELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPW
FT                   HPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFGHDSG
FT                   FEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVD
FT                   AAVTPEERHLSKMQQNGYENPTYKFFEQMQN"
FT   misc_difference 2536..2541
FT                   /gene="App"
FT                   /note="polyA tail: 6 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2541 BP; 697 A; 610 C; 652 G; 582 T; 0 other;
     ctaacttgca cgactatggc atgctgctgc cctgcggcat cgacaagttc cgaggggtag        60
     agtttgtatg ctgcccgttg gccgaggaaa gcgacagcgt ggattctgcg gatgcagagg       120
     aggatgactc tgatgtctgg tggggtggag cggacacaga ctacgctgat ggcggtgaag       180
     acaaagtagt agaagtcgcc gaagaggagg aagtggctga tgttgaggaa gaggaagctg       240
     atgatgatga ggatgtggag gatggggacg aggtggagga ggaggccgag gagccctacg       300
     aagaggccac cgagagaaca accagcactg ccaccaccac cacaaccacc actgagtccg       360
     tggaggaggt ggtccgagag gtgtgctctg aacaagccga gaccgggcca tgccgcgcaa       420
     tgatctcccg ctggtacttt gatgtcactg aagggaagtg tgtcccattc ttttacggcg       480
     gatgtggcgg caacaggaac aactttgaca cggaagagta ctgcatggcg gtgtgtggca       540
     gcgtgtcaac ccaaagttta ctcaagacta ccagtgaacc tcttccccaa gatcctgata       600
     aacttcccac gacagcagcc agcacccccg acgccgtcga caagtacctg gagacacccg       660
     gggacgagaa cgagcatgcc catttccaga aagccaaaga gaggctggaa gccaagcacc       720
     gagagagaat gtcccaggtc atgagagaat gggaagaggc agagcgtcaa gccaagaact       780
     tgcccaaagc tgacaagaag gccgttatcc agcatttcca ggagaaagtg gaatctctgg       840
     aacaggaagc agccaatgag agacagcagc ttgtagagac acacatggcc agagttgaag       900
     ccatgctcaa tgaccgccgc cgcctggccc tcgagaatta catcactgca ctgcaggcgg       960
     tgcccccaag gcctcatcat gtgttcaaca tgctgaagaa gtacgtccgt gcggagcaga      1020
     aagacagaca gcacacccta aagcattttg aacatgtgcg catggtggac cccaagaaag      1080
     ctgctcagat ccggtcccag gttatgacac acctccgtgt gatctacgag cgcatgaacc      1140
     agtctctgtc cctgctctac aatgtccctg cggtggctga ggagattcaa gatgaagtcg      1200
     atgagctgct tcagaaggag cagaactact ccgacgatgt cttggccaac atgatcagtg      1260
     agcccagaat cagctacgga aacgacgctc tcatgccttc gctgacggaa accaagacca      1320
     ccgtggagct ccttcccgtg aatggggaat tcagcctgga tgacctccag ccgtggcacc      1380
     cttttggggt ggactctgtg ccagccaata ccgaaaatga agtcgagcct gttgacgccc      1440
     gccccgctgc tgaccgagga ctgaccactc gaccaggttc tgggctgaca aacatcaaga      1500
     cggaagagat ctcggaagtg aagatggatg cagaattcgg acatgattca ggatttgaag      1560
     tccgccatca aaaactggtg ttctttgctg aagatgtggg ttcgaacaaa ggcgccatca      1620
     tcggactcat ggtgggcggc gttgtcatag caaccgtgat tgtcatcacc ctggtgatgt      1680
     tgaagaagaa acagtacaca tccatccatc atggcgtggt ggaggtcgac gccgccgtga      1740
     ccccagagga gcgccatctc tccaagatgc agcagaacgg atatgagaat ccaacttaca      1800
     agttctttga gcaaatgcag aactaagccc cacccgcgcc acagcagcgg cctctgaact      1860
     tggacagcga aaccattgct tcactaccca tcggtgttca tttataaaat aacgtggaaa      1920
     gaaacaaacc cttccgttta tttactcacc ctcggctttt gacagctgtg ctgtaacaca      1980
     agtagatgcc tgaacttgaa ttaatataca aatcagtaat gtattctcgc tttctctctt      2040
     tacattctgg tctctacatt acatgattca tgggttttgt gtactgtaaa aaaaaaaatt      2100
     agctgtatca aactagtgca tgaatagatt ctctcctaat tatttatcac atacatagcc      2160
     ccttagcccg ttgtatatta ttcttgtggt ttgtggcccg gaaaaaactc ctacttgaaa      2220
     tatgctttaa aaatcgatgg gggatgcttc ttgtgaacgt gggcgtctag ctgcttctcc      2280
     tacgtattct tttcctgatc actatgcatt ttgaacattt ttttaagtat tccaaatgac      2340
     ttagaaaatt ctttttccat gactgcatct tactgtacag attgctgctt ctgctctctt      2400
     tgtgatatag gaataagagg atacacattg atttctttgt gcctgtttta tgtgcacaca      2460
     ttaggcattg agaatttgaa catttttttt gtccatgtat ctttggatct ttgataaaaa      2520
     aaaattaaaa aaaaaaaaaa a                                                2541
//