Dbfetch

ID   BC005117; SV 1; linear; mRNA; STD; HUM; 1072 BP.
XX
AC   BC005117;
XX
DT   30-MAR-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Homo sapiens ubiquitin carboxyl-terminal esterase L1 (ubiquitin
DE   thiolesterase), mRNA (cDNA clone MGC:3601 IMAGE:2823559), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1072
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1072
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (26-MAR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5ab0356b8f4556231da193e15505615d.
DR   Ensembl-Gn; ENSG00000154277; homo_sapiens.
DR   Ensembl-Tr; ENST00000284440; homo_sapiens.
DR   Ensembl-Tr; ENST00000503431; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: DCTD/DTP
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 9 Row: e Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34147658.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1072
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_7"
FT                   /clone="MGC:3601 IMAGE:2823559"
FT                   /tissue_type="Lung, small cell carcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1072
FT                   /gene="UCHL1"
FT                   /note="synonym: PGP9.5"
FT   CDS             25..696
FT                   /codon_start=1
FT                   /gene="UCHL1"
FT                   /product="ubiquitin carboxyl-terminal esterase L1
FT                   (ubiquitin thiolesterase)"
FT                   /db_xref="GOA:P09936"
FT                   /db_xref="H-InvDB:HIT000032221.18"
FT                   /db_xref="HGNC:HGNC:12513"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="PDB:2ETL"
FT                   /db_xref="PDB:2LEN"
FT                   /db_xref="PDB:3IFW"
FT                   /db_xref="PDB:3IRT"
FT                   /db_xref="PDB:3KVF"
FT                   /db_xref="PDB:3KW5"
FT                   /db_xref="PDB:4DM9"
FT                   /db_xref="PDB:4JKJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09936"
FT                   /protein_id="AAH05117.1"
FT                   /translation="MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAP
FT                   ACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQD
FT                   KLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFI
FT                   LFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKA
FT                   A"
FT   misc_difference 1053..1072
FT                   /gene="UCHL1"
FT                   /note="polyA tail: 20 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1072 BP; 283 A; 256 C; 274 G; 259 T; 0 other;
     atttctgccg ggcgctccgc gaagatgcag ctcaagccga tggagatcaa ccccgagatg        60
     ctgaacaaag tgctgtcccg gctgggggtc gccggccagt ggcgcttcgt ggacgtgctg       120
     gggctggaag aggagtctct gggctcggtg ccagcgcctg cctgcgcgct gctgctgctg       180
     tttcccctca cggcccagca tgagaacttc aggaaaaagc agattgaaga gctgaaggga       240
     caagaagtta gtcctaaagt gtacttcatg aagcagacca ttgggaattc ctgtggcaca       300
     atcggactta ttcacgcagt ggccaataat caagacaaac tgggatttga ggatggatca       360
     gttctgaaac agtttctttc tgaaacagag aaaatgtccc ctgaagacag agcaaaatgc       420
     tttgaaaaga atgaggccat acaggcagcc catgatgccg tggcacagga aggccaatgt       480
     cgggtagatg acaaggtgaa tttccatttt attctgttta acaacgtgga tggccacctc       540
     tatgaacttg atggacgaat gccttttccg gtgaaccatg gcgccagttc agaggacacc       600
     ctgctgaagg acgctgccaa ggtctgcaga gaattcaccg agcgtgagca aggagaagtc       660
     cgcttctctg ccgtggctct ctgcaaggca gcctaatgct ctgtgggagg gactttgctg       720
     atttcccctc ttcccttcaa catgaaaata tatacccccc catgcagtct aaaatgcttc       780
     agtacttgtg aaacacagct gttcttctgt tctgcagaca cgccttcccc tcagccacac       840
     ccaggcactt aagcacaagc agagtgcaca gctgtccact gggccattgt ggtgtgagct       900
     tcagatggtg aagcattctc cccagtgtat gtcttgtatc cgatatctaa cgctttaaat       960
     ggctactttg gtttctgtct gtaagttaag accttggatg tggtttaatt gtttgtcctc      1020
     aaaaggaata aaacttttct gctgataaga taaaaaaaaa aaaaaaaaaa aa              1072
//