spacer

EBI Dbfetch

ID   BC004808; SV 1; linear; mRNA; STD; MUS; 2643 BP.
XX
AC   BC004808;
XX
DT   25-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus signal transducer and activator of transcription 1, mRNA (cDNA
DE   clone MGC:6411 IMAGE:3587831), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2643
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2643
RA   Strausberg R.;
RT   ;
RL   Submitted (21-MAR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 491fd4d6f5032b6dfa758eba7a0fe0f7.
DR   Ensembl-Gn; ENSMUSG00000026104; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070968; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 10 Row: a Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6678152.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2643
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="CZECH II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:6411 IMAGE:3587831"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2643
FT                   /gene="Stat1"
FT   CDS             287..2425
FT                   /codon_start=1
FT                   /product="Stat1 protein"
FT                   /db_xref="GOA:Q99K94"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001217"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR012345"
FT                   /db_xref="InterPro:IPR013799"
FT                   /db_xref="InterPro:IPR013800"
FT                   /db_xref="InterPro:IPR013801"
FT                   /db_xref="InterPro:IPR015988"
FT                   /db_xref="MGI:MGI:103063"
FT                   /db_xref="UniProtKB/TrEMBL:Q99K94"
FT                   /protein_id="AAH04808.1"
FT                   /translation="MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEH
FT                   AAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMI
FT                   IYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEQEIKTL
FT                   EELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLN
FT                   SIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAETLQQIRQQLKKLE
FT                   ELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQ
FT                   FTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGS
FT                   LAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVI
FT                   SNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNAD
FT                   QLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDG
FT                   CIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYT
FT                   KKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELD
FT                   DPKRTGYIKTELISVSEV"
FT   misc_feature    290..652
FT                   /note="STAT_prot; Region: STAT protein, protein interaction
FT                   domain. STAT proteins (Signal Transducers and Activators of
FT                   Transcription) are a family of transcription factors that
FT                   are specifically activated to regulate gene transcription
FT                   when cells encounter cytokines and growth factors. STAT
FT                   proteins also include an SH2 domain pfam00017"
FT   misc_feature    692..1231
FT                   /note="STAT; Region: STAT protein, all-alpha domain. STAT
FT                   proteins (Signal Transducers and Activators of
FT                   Transcription) are a family of transcription factors that
FT                   are specifically activated to regulate gene transcription
FT                   when cells encounter cytokines and growth factors. STAT
FT                   proteins also include an SH2 domain pfam00017"
FT   misc_feature    1235..1987
FT                   /note="STAT_bind; Region: STAT protein, DNA binding domain.
FT                   STAT proteins (Signal Transducers and Activators of
FT                   Transcription) are a family of transcription factors that
FT                   are specifically activated to regulate gene transcription
FT                   when cells encounter cytokines and growth factors. This
FT                   family represents the DNA binding domain of STAT, which has
FT                   an ig-like fold. STAT proteins also include an SH2 domain
FT                   pfam00017"
FT   misc_feature    2018..2152
FT                   /note="SH2; Region: SH2 domain"
XX
SQ   Sequence 2643 BP; 737 A; 653 C; 669 G; 584 T; 0 other;
     gtcaaagctc cctggagacc tccgggaccg cgcccctcag acccacttgg gacactgctg        60
     agcggcgcag agagatttgc ccagactcga gctcctgcgt gcagtgagtg agtgagagcc       120
     agtcgtttca gctctgctcc ataccctgag ccggccccac gccgccgcgc atgcaactgg       180
     catataactt gctgtgtgtg gtgattgctt gtgttgaatc ccgaacctgc ccccggagac       240
     agcccagtaa gtctacgtgg gaacggaagc atttggaatc tcaaggatgt cacagtggtt       300
     cgagcttcag cagctggact ccaagttcct ggagcaggtc caccagctgt acgatgacag       360
     tttccccatg gaaatcagac agtacctggc ccagtggctg gaaaagcaag actgggagca       420
     cgctgcctat gatgtctcgt ttgcgaccat ccgcttccac gacctcctct cgcagctgga       480
     cgaccagtac agccgctttt ctctggagaa taatttcttg ttgcagcaca acatacggaa       540
     aagcaagcgt aatctccagg ataacttcca agaagatccc gtacagatgt ccatgatcat       600
     ctacaactgt ctgaaggaag aaaggaagat tttggaaaat gcccaaagat ttaatcaggc       660
     ccaggaggga aatattcaga acactgtgat gttagataaa cagaaggagc tggacagtaa       720
     agtcagaaat gtgaaggatc aagtcatgtg catagagcag gaaatcaaga ccctagaaga       780
     attacaagat gaatatgact ttaaatgcaa aacctctcag aacagagaag gtgaagccaa       840
     tggtgtggcg aagagcgacc aaaaacagga acagctgctg ctccacaaga tgtttttaat       900
     gcttgacaat aagagaaagg agataattca caaaatcaga gagttgctga attccatcga       960
     gctcactcag aacactctga ttaatgacga gctcgtggag tggaagcgaa ggcagcagag      1020
     cgcctgcatc gggggaccgc ccaacgcctg cctggatcag ctgcaaagct ggttcaccat      1080
     tgttgcagag accctgcagc agatccgtca gcagcttaaa aagctggagg agttggaaca      1140
     gaaattcacc tatgagcccg accctattac aaaaaacaag caggtgttgt cagatcgaac      1200
     cttcctcctc ttccagcagc tcattcagag ctccttcgtg gtagaacgac agccgtgcat      1260
     gcccactcac ccgcagaggc ccctggtctt gaagactggg gtacagttca ctgtcaagct      1320
     gagactgttg gtgaaattgc aagagctgaa ctataacttg aaagtgaaag tctcatttga      1380
     caaagatgtg aacgagaaaa acacagtaaa aggatttcgg aagttcaaca tcttgggtac      1440
     gcacacaaaa gtgatgaaca tggaagaatc caccaacgga agtctggcag ctgagttccg      1500
     acacctgcaa ctgaaggaac agaaaaacgc tgggaacaga actaatgagg ggcctctcat      1560
     tgtcaccgaa gaacttcact ctcttagctt tgaaacccag ttgtgccagc caggcttggt      1620
     gattgacctg gagaccacct ctcttcctgt cgtggtgatc tccaacgtca gccagctccc      1680
     cagtggctgg gcgtctatcc tgtggtacaa catgctggtg acagagccca ggaatctctc      1740
     cttcttcctg aatcccccgt gcgcgtggtg gtcccagctc tcagaggtgt tgagttggca      1800
     gttttcatca gtcaccaaga gaggtctgaa cgcagaccag ctgagcatgc tgggagagaa      1860
     gctgctgggc cctaatgctg gccctgatgg tcttattcca tggacaaggt tttgtaagga      1920
     aaatattaat gataaaaatt tctccttctg gccttggatt gacaccatcc tagagctcat      1980
     taagaagcac ctgctgtgcc tctggaatga tgggtgcatt atgggcttca tcagcaagga      2040
     gcgagaacgc gctctgctca aggaccagca gccagggacg ttcctgctta ggttcagtga      2100
     gagctcccgg gaaggggcca tcacattcac atgggtggaa cggtcccaga acggaggtga      2160
     acctgacttc catgctgtgg agccctacac gaaaaaagag ctttcagctg ttactttccc      2220
     agatattatt cgcaactaca aagtcatggc tgccgagaac ataccagaga atcccctgaa      2280
     gtatctgtac cccaatattg acaaagacca cgcctttggg aagtattatt ccagaccaaa      2340
     ggaagcacca gaaccgatgg agcttgacga ccctaagcga actggataca tcaagactga      2400
     gttgatttct gtgtctgaag tgtaagtgag cacagaagac tggcttactg gcttgttcag      2460
     gaccgcaggc cagccccgtc cctggctgcg gtccattgat tgcactggct catggctcat      2520
     ggcttgcttt cccaatgtaa ctgatgttgc caccacagtt ggacattctg gaaagtttgt      2580
     aactagtcct ggtgtcaatg cttactggca ttttattgcc atgagataaa aaaaaaaaaa      2640
     aaa                                                                    2643
//


spacer
spacer