Dbfetch

ID   BC004689; SV 1; linear; mRNA; STD; MUS; 1229 BP.
XX
AC   BC004689;
XX
DT   25-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus N-acetylglucosamine kinase, mRNA (cDNA clone MGC:5669
DE   IMAGE:3501470), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1229
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1229
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (21-MAR-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c6f0ab4f39dba2c173fbf471f5de8b3f.
DR   Ensembl-Gn; ENSMUSG00000034744; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030941; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030910; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030838; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030920; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031380; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030029; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030607; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030760; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030713; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030839; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030749; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031404; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029744; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030110; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000037376; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0078375; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0078451; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0078368; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0078394; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0078860; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0078590; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0077971; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0078133; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0078021; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0078161; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0078021; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0079103; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0078015; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0077124; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 9 Row: a Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 9506738.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1229
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:5669 IMAGE:3501470"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1229
FT                   /gene="Nagk"
FT                   /note="synonym: Gnk"
FT   misc_difference 1..11
FT                   /gene="Nagk"
FT                   /note="11 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             76..1107
FT                   /codon_start=1
FT                   /gene="Nagk"
FT                   /product="N-acetylglucosamine kinase"
FT                   /db_xref="GOA:Q9QZ08"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="MGI:MGI:1860418"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZ08"
FT                   /protein_id="AAH04689.1"
FT                   /translation="MAALYGGVEGGGTRSKVLLLSEDGQILAEADGLSTNHWLIGTDQC
FT                   VERINEMVDRAKQKAGVDPLVPLRSLGLSLSGGEQEDAVRLLIEELRHRFPNLSENYLI
FT                   TTDAAGSIATATPDGGIVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQA
FT                   VKIVFDSIDNLEAAPHDIGHVKQAMFDYFQVPDRLGILTHLYRDFDKCKFAGFCQKIAE
FT                   GAHQGDPLSRYIFRKAGEMLGRHVVAVLPEIDPVLFQGELGLPILCVGSVWKSWELLKE
FT                   GFLLALTLGREQQAQNSFSSFTLMKLRHSSALGGASLGARHIGYHLPMDYSINAIAFYS
FT                   YTF"
FT   misc_difference 1209..1229
FT                   /gene="Nagk"
FT                   /note="polyA tail: 21 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1229 BP; 295 A; 302 C; 358 G; 274 T; 0 other;
     cccacgcgtc cggcgggagc gaagtcacgg ctagggtcga ggttgctacg gcggaccagc        60
     ggtggcaacg gtagtatggc cgcgctttat ggtggcgtgg aagggggagg cacacggtcc       120
     aaagtccttt tactttctga ggatgggcag atcctggcag aagcagatgg actgagcaca       180
     aaccactggc tgattggcac agaccagtgt gtggagagga tcaatgagat ggtggacagg       240
     gccaaacaga aggctggagt ggatcctctg gtgccccttc gaagcctggg cctgtccctg       300
     agtggtgggg agcaggagga tgcagtgagg ctcctgattg aggagttgag gcaccgcttt       360
     cccaacctga gtgaaaacta cttaatcacc acggatgcag caggttccat cgccacagcc       420
     acaccggacg gtgggattgt gctcatctct ggaacaggct ccaactgtag gcttatcaac       480
     cctgatggct ccgagagtgg ctgtggaggc tggggccaca tgatgggaga cgagggctca       540
     gcctactgga ttgcacacca agctgtgaaa attgtgtttg attccatcga caacctggag       600
     gcagctcctc atgatattgg ccatgtcaag caggccatgt tcgactattt ccaggtgcca       660
     gatcggcttg gaatcctcac ccatttgtat agggactttg ataaatgcaa gtttgctgga       720
     ttttgccaga aaattgcaga aggtgcacat cagggagacc ctctttccag gtacatcttc       780
     aggaaggctg gagagatgct gggcagacat gttgtggcag tattgccaga gattgacccg       840
     gttttgttcc aaggggagct tggcctcccc attctgtgtg tgggctcagt gtggaagagc       900
     tgggagctcc tgaaggaagg ctttctcctg gcgctgacgc tgggccgaga gcagcaggca       960
     cagaactcct tctccagctt caccctgatg aagttgcggc attcttctgc attggggggt      1020
     gccagcctgg gggccaggca cattggatac caccttccca tggactacag tatcaatgcc      1080
     attgccttct attcctatac cttctagagt ctgtccccct gcccaaccag ccaacaccga      1140
     gagctgggag actttccttt ttaaaaaaca catatggaag aaaataaatg cactttactc      1200
     cttccctaaa aaaaaaaaaa aaaaaaaaa                                        1229
//