spacer

EBI Dbfetch

ID   BC003943; SV 1; linear; mRNA; STD; MUS; 1639 BP.
XX
AC   BC003943;
XX
DT   17-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus dolichyl-phosphate (UDP-N-acetylglucosamine)
DE   acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase), mRNA (cDNA
DE   clone MGC:7350 IMAGE:3487188), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1639
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1639
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (28-FEB-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d80f1bfb3e343fb0d3745c14d5a8685a.
DR   Ensembl-Gn; ENSMUSG00000032123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054708; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 7 Row: l Column: 19.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1639
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:7350 IMAGE:3487188"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1639
FT                   /gene="Dpagt1"
FT   CDS             179..1084
FT                   /codon_start=1
FT                   /gene="Dpagt1"
FT                   /product="Dpagt1 protein"
FT                   /db_xref="GOA:Q9CPT1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="MGI:MGI:1196396"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CPT1"
FT                   /protein_id="AAH03943.1"
FT                   /translation="MIFLGFADDVLNLRWRHKLLLPTAASLPLLMVYFTNFGNTTIVVP
FT                   KPFRWILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNLV
FT                   ELEGDYRDDHIFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGH
FT                   FSKTMLLFFMPQVFNFLYSLPQLFHIIPCPRHRMPRLNAKTGKLEMSYSKFKTKNLSFL
FT                   GTFILKVAENLRLVTVHQGESEDGAFTECNNMTLINLLLKVFGPIHERNLTLLLLLLQV
FT                   LSSAATFSIRYQLVRLFYDV"
FT   misc_difference 1137
FT                   /gene="Dpagt1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1564..1639
FT                   /gene="Dpagt1"
FT                   /note="polyA tail: 76 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1639 BP; 397 A; 454 C; 346 G; 442 T; 0 other;
     gctcagccag cagcagatcc cagagtccca gggagtgatc agcggtgctg ttttccttat        60
     catcctcttc tgcttcatcc ctttcccctt cctgaactgc ttcgtggagg agcagtgtaa       120
     ggcattcccc caccatgaat ttgtggccct aataggtgcc ctccttgcca tctgctgcat       180
     gatcttcctg gggtttgctg atgatgtcct caatctccgc tggcgccaca agctgctgct       240
     gcccacagct gcctcactac ctctcctcat ggtctacttc acaaactttg gcaatacaac       300
     catcgtggtg cccaagccct tccgctggat tctgggcctg catttggact tggggatcct       360
     gtactacgtc tacatggggc tgcttgcagt gttctgtacc aatgccatca acatcctggc       420
     gggcattaat ggcctagagg ccggtcagtc actagtcatc tctgcttcta tcattgtctt       480
     caacctggtg gaactggaag gtgattatcg agatgatcat atcttttccc tttacttcat       540
     gataccattt ttctttacca ccttgggact gctttaccac aactggtacc cgtcccgcgt       600
     gtttgtggga gacaccttct gttactttgc gggcatgact tttgccgtgg tggggatctt       660
     gggacacttc agcaagacca tgctgctctt ctttatgcca caagtattca atttcctcta       720
     ctcactgcct cagctcttcc atatcatccc ctgccctcga caccggatgc ccagactcaa       780
     cgcaaagaca ggcaaactgg aaatgagcta ttccaagttc aagaccaaga acctctcttt       840
     cctgggcacc tttattttaa aggtagcaga gaacctccgg ttagtgacag ttcaccaagg       900
     tgagagtgag gacggtgcct tcactgagtg taacaacatg accctcatca acttgctact       960
     taaagtcttt gggcctatac atgagagaaa cctcaccctg ctcctgctgc tcctgcaggt      1020
     cctaagcagc gccgccacct tctccattcg ttaccaactc gtccgactct tctatgatgt      1080
     ctgagctccc tgacagctgc cctttacctc acagtctcca ttggacctca gccagggcca      1140
     gcctctgtct ggtccgagat gaccctctgg tccaggcctc gctgacactt ttgttctcag      1200
     cttctgccat ctgtgactac tgatatcctg gatggacacc ttgctggact tgaagtccgc      1260
     tagttggact ttgcctaggg ctttcatctt gccttgccct ccctttctgt cccatctgca      1320
     gcctcaccag gtgggcttgt agcctctatt atgcaaatat tcgtagctca gctttcagag      1380
     cgctaactct aaaggaattc acctgagcct tgagagagaa cctgggctag ggctagagtt      1440
     agggctacat actccaaggt gacctcacat ttgactatca aatgaagtgt tgtgattggg      1500
     aagcgtagag gcagggccat gtgctcagaa cggtgacaat aaaggactgc cttttacttg      1560
     ttcaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1620
     aaaaaaaaaa aaaaaaaaa                                                   1639
//


spacer
spacer