spacer

EBI Dbfetch

ID   BC003852; SV 1; linear; mRNA; STD; MUS; 1688 BP.
XX
AC   BC003852;
XX
DT   17-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Mus musculus CDP-diacylglycerol synthase (phosphatidate
DE   cytidylyltransferase) 2, mRNA (cDNA clone MGC:6431 IMAGE:3600825), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1688
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1688
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (28-FEB-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 34b769d4f72d3712a276bacd258ffdfc.
DR   Ensembl-Gn; ENSMUSG00000058793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103181; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 11 Row: p Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31542373.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1688
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:6431 IMAGE:3600825"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1688
FT                   /gene="Cds2"
FT   CDS             203..1537
FT                   /codon_start=1
FT                   /gene="Cds2"
FT                   /product="CDP-diacylglycerol synthase (phosphatidate
FT                   cytidylyltransferase) 2"
FT                   /db_xref="GOA:Q99L43"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="MGI:MGI:1332236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99L43"
FT                   /protein_id="AAH03852.1"
FT                   /translation="MTELRQRVVREDAPPEDKESESEAKLDGETASDSESRAETAPLPT
FT                   SVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKC
FT                   FHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSK
FT                   YHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMI
FT                   WFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMS
FT                   GYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIA
FT                   LSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASF
FT                   IRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILTSALEDE"
FT   misc_difference 1639..1688
FT                   /gene="Cds2"
FT                   /note="polyA tail: 50 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1688 BP; 392 A; 443 C; 442 G; 411 T; 0 other;
     gcggctccgc tctccgggca agggcggcgg cagcggtgct gggcggggcc gggctcgggg        60
     ctagtggcgc tgctgcaggg gctgtgcgag gcacggtggg gctgcgaggt gctcgggccc       120
     gccgagagcc cgtgctcact gagccgaccc ccgcggccac cgtgctgctc actcggggtg       180
     acgtcgcgcc ggggtcccca gcatgaccga actacggcag agggttgtcc gcgaggacgc       240
     acctccggag gacaaggaat cagagtccga agcaaagcta gatggagaga cagcgtctga       300
     cagcgagagc cgagcggaaa cagctcccct accaacctcc gtagatgaca ccccagaggt       360
     ccttaacagg gccctttcca acctgtcctc aaggtggaag aactggtggg tgagaggcat       420
     cctgactttg gccatgatcg cgtttttctt cattatcatt tacctgggac caatggtttt       480
     gatgatgatt gttatgtgtg tccagattaa gtgtttccat gaaataatca ctattggcta       540
     caatgtatac cactcctacg acctgccctg gttcaggacc ctcagctggt acttcctgct       600
     gtgtgtgaac tacttcttct atggggagac agtgacggac tacttcttca ctctggtcca       660
     gagagaggag cctttgcgga tcctcagtaa ataccaccgg ttcatctcct ttgccctgta       720
     tctgacagga ttctgcatgt ttgtactgag tctagttaag aagcattatc ggctgcagtt       780
     ctacatgttt ggctggaccc atgtgacctt gcttattgtc gtaacgcagt cacaccttgt       840
     tatccataac ttgtttgaag gaatgatatg gtttattgtt cccatctcgt gcgtcatctg       900
     caatgacatt atggcctata tgtttggctt tttctttggt cggaccccac tcattaagct       960
     ctctccaaag aagacctggg aaggcttcat tgggggcttc tttgccactg tggtgtttgg      1020
     ccttttgctc tcctatgtga tgtctgggta cagatgcttc gtgtgtcccg tggaatacaa      1080
     caatgacacc aacagcttca ctgtggactg tgagccgtct gacctattcc gcctgcagga      1140
     gtacaacatc cctggggtga tccagtcggc cattggctgg aaaacggtga ggatgtaccc      1200
     tttccagatc cacagcatcg ccctctccac cttcgcctcg ctcatcggcc ctttcggagg      1260
     gttcttcgcc agtggattca aacgggcctt taaaatcaaa gattttgcca ataccattcc      1320
     cggtcatgga ggcatcatgg atcgctttga ctgccagtac ctgatggcca cctttgtcaa      1380
     tgtgtacatc gccagcttta tcaggggtcc aaacccaagc aaactgatcc agcagtttct      1440
     gacgttgcgg ccagatcagc agcttcacat cttcaacacg ctcaagtctc acctaactga      1500
     caaggggatt ctgacatctg ccttggaaga tgagtagagt ccacctgggg cccagagagc      1560
     tggagcagga tggagtgggg gccagtcgcc aaggccgccc agctgctgtg acttagataa      1620
     tgaaaagctt caactcacta aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1680
     aaaaaaaa                                                               1688
//


spacer
spacer