Dbfetch

ID   BC003763; SV 1; linear; mRNA; STD; MUS; 2723 BP.
XX
AC   BC003763;
XX
DT   17-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha, mRNA
DE   (cDNA clone MGC:5928 IMAGE:3591003), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2723
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2723
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (28-FEB-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a91419e0dea0eb8d0842cd0fc339e831.
DR   Ensembl-Gn; ENSMUSG00000028126; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027566; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027525; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027492; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027537; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027270; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027985; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026720; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027247; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027386; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027357; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027495; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027384; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028039; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026448; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026802; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000107233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107236; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062312; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0062337; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0062273; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062263; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061949; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062761; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062251; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0061920; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0062027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0062002; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0062168; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062002; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062953; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061789; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061222; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 11 Row: k Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982832.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2723
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="MGC:5928 IMAGE:3591003"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2723
FT                   /gene="Pip5k1a"
FT                   /note="synonym: Pipk5a"
FT   CDS             116..1177
FT                   /codon_start=1
FT                   /gene="Pip5k1a"
FT                   /product="Pip5k1a protein"
FT                   /db_xref="GOA:P70182"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="MGI:MGI:107929"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70182"
FT                   /protein_id="AAH03763.1"
FT                   /translation="MASASSGPAAAGFSSLDAGAPAGTAAAASGIKRATVSEGPSASVM
FT                   PVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVES
FT                   IFFPSEGSNLTPAHHYSDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSG
FT                   ASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGG
FT                   KNIRIVVMNNLLPRSVNTVFKKIPLKPSPTKKFRSGPSFSRRSGPSGNSCTSQLMASGE
FT                   HRAQVTTKAEVEPDVHLGRPDVLPQTPPLEEISEGSPVPGPSFSPVVGQPLQILNLSST
FT                   LEKLDVAESEFTH"
FT   misc_difference 463
FT                   /gene="Pip5k1a"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 477
FT                   /gene="Pip5k1a"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'S' in cDNA, 'N' in the mouse genome."
FT   misc_difference 832
FT                   /gene="Pip5k1a"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'N' in cDNA, 'K' in the mouse genome."
FT   misc_difference 1651
FT                   /gene="Pip5k1a"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1678^1679
FT                   /gene="Pip5k1a"
FT                   /note="9 bases in the mouse genome, AAAAAAAAA, are not
FT                   found in cDNA."
FT   misc_difference 1850
FT                   /gene="Pip5k1a"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 2702..2723
FT                   /gene="Pip5k1a"
FT                   /note="polyA tail: 22 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2723 BP; 675 A; 650 C; 651 G; 747 T; 0 other;
     gagaagcccg ccgaacgcgg gttctgtgaa gagacgtggg gaagattcga ttccgagaaa        60
     aggaaaagcc ggattgaaag ggagcgaagc cgctgagggg gagggggctg ccaagatggc       120
     gtccgcctcc tcagggccag cggcggccgg gttttcatcc cttgatgccg gggcccctgc       180
     tggtaccgca gcagcagcat ctggaatcaa gagagccaca gtatctgagg gaccttccgc       240
     ctctgtcatg cctgttaaaa aaataggcca tcgaagtgtt gattcctctg gagagactac       300
     atacaagaag acaacttcat cagccttgaa aggtgccatc cagttaggca tcactcacac       360
     tgtgggcagc ctgagcacca aaccagagcg tgatgtcctc atgcaagact tctacgtggt       420
     ggagagcatc tttttcccca gtgaaggcag caacctgaca ccagctcacc attacagtga       480
     ctttcgattc aagacctatg cgcctgttgc cttccgttac ttcagagagc tctttggcat       540
     ccggcctgat gattacttgt actccctttg cagtgagcca ttgattgaac tctccaattc       600
     tggagctagt ggttccctct tctatgtgtc cagtgatgat gaattcatca ttaagaccgt       660
     ccagcataaa gaagcagaat ttctgcagaa gttgcttcca ggatactaca tgaatcttaa       720
     ccaaaaccct cgtactttgc tgcccaaatt ttatggattg tactgtgtgc aagcaggcgg       780
     caagaacata cgaattgtgg tgatgaacaa tctcttgcct cggtcagtca acacagtgtt       840
     caagaagatt cccttgaagc cttctcctac caaaaagttt cggtctggcc cgtctttctc       900
     tcggcgatca ggccccagcg gcaactcctg cacctcccag ctgatggcct ctggggaaca       960
     cagagcacaa gtgaccacca aggcggaagt ggagccagat gtacaccttg ggcgtcctga      1020
     tgtcttacct cagactccac ctttggagga aataagtgag ggttcacctg ttcctggccc      1080
     cagtttctca cctgtagttg gacaaccttt gcaaatacta aatttgagtt caaccttgga      1140
     aaagcttgat gttgcagagt cagagttcac ccactgagca gtgagcctca gaagacctga      1200
     aacaagactc tgctgtcgct ttgatcccaa gatgtcagcc cttgccccag gaatgctgaa      1260
     tcgtcttctt ggtcatcaac agaggagaga atgtggagct agcagggctc tgacactgtc      1320
     tccccttcct ctgggcagta gtgcctttga cagttgagga cagcatcgtc cccaccactc      1380
     cagaagtggg tggcgtgaat tttccactgc ctgccatggc ttctatagct gaatattttt      1440
     caaaccccca ttctttgtgc tgacatgggg ttgctggact ggtggtttcc tcctgtttac      1500
     ctttctcctg gagctggact cttcatttcc tcaggacgga ctggctggac attgttcctg      1560
     ccttggctct cccgctggtc tttggagact cccaatgatt tgtataaagg tgtttggggg      1620
     aaagtaagga tcatccttac tcccaacctt gttttcctta aaaaaggaaa aaaaaaaaca      1680
     caaagagcac acaatgtaaa tttgagccag tctcagataa aagttctcta agtgttgtag      1740
     aagagcccta gtgtttgtga agcagaaagg ctggggctgc cccaccagca gctgctctct      1800
     gactccctca cttagggttg agggaataga gagggcctgg cccttttttt aagacaaagg      1860
     ggcagccatg ttaggagagt ggaccttagc aggaccctac tcactgccag gtcttcggtt      1920
     attactattc tgcaatttgg aatgtatcct catagttttt tctagatata aagaattatc      1980
     aaatgatttt agaccattct ccaaaggaga tttctttgtt cttcctatat tttccaacag      2040
     tattctgctc tttgtggagc tacggtggag ggagatgttt gtgtctgttt aacaggcagt      2100
     ctgtatctat gaggctagag aatattttct taaactccta gggagccaca gacttccctc      2160
     tgtacggttg tcgccatgtc acctggcctg cccttactct gcagagaagc tggaaatggg      2220
     gccacggagc cctctccttc ctctcagttg tggcccatct ggtcctggct ggtggggcag      2280
     tgcatggtgt ttcaggctgg ctgttgaaat cccacattag ttccttccct gtcccgtccc      2340
     accttgatag caggttagcc aacccccacg taactgtcta tattagacac ccccagccac      2400
     cttctggctg cctgtctttg ctgccatgtt cttttttaca agaaggaaac aaacaatttc      2460
     ttgctatttt tttttcataa tttactattt atgatgtatt taagtgtttt attcaggaca      2520
     gggttctgta aggggtggga gggagtattt gagggagggc tgggacttag ggaaaggaca      2580
     tgggattcaa catttttatg gagtgttact atttgcctct actttgtatt gttgaaaaat      2640
     gacagatgca atataaaagt aataaatatc tggttttaat gtattaaagt tctagcaatc      2700
     aaaaaaaaaa aaaaaaaaaa aaa                                              2723
//