spacer

EBI Dbfetch

ID   BC003438; SV 1; linear; mRNA; STD; MUS; 3273 BP.
XX
AC   BC003438;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus solute carrier family 40 (iron-regulated transporter), member
DE   1, mRNA (cDNA clone MGC:6489 IMAGE:2647365), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3273
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3273
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (20-FEB-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 255c4d4769efdbab02aed4b935400b34.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   RFAM; RF02253; IRE_II.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 5 Row: m Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 8394303.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3273
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:6489 IMAGE:2647365"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3273
FT                   /gene="Slc40a1"
FT                   /note="synonyms: Fpn1, Slc39a1, MTP, Ol5, IREG1, MTP1"
FT   misc_difference 198
FT                   /gene="Slc40a1"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 281
FT                   /gene="Slc40a1"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   CDS             301..2013
FT                   /codon_start=1
FT                   /gene="Slc40a1"
FT                   /product="solute carrier family 40 (iron-regulated
FT                   transporter), member 1"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="AAH03438.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVI
FT                   LCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVA
FT                   GENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFL
FT                   LWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQE
FT                   PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGS
FT                   ILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLD
FT                   LSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLF
FT                   AGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPE
FT                   AFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
FT   misc_difference 588
FT                   /gene="Slc40a1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 921
FT                   /gene="Slc40a1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2120
FT                   /gene="Slc40a1"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2196
FT                   /gene="Slc40a1"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2237
FT                   /gene="Slc40a1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2243
FT                   /gene="Slc40a1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2276
FT                   /gene="Slc40a1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2292
FT                   /gene="Slc40a1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2348
FT                   /gene="Slc40a1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2353
FT                   /gene="Slc40a1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2390
FT                   /gene="Slc40a1"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2396
FT                   /gene="Slc40a1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2410^2411
FT                   /gene="Slc40a1"
FT                   /note="1 base in the mouse genome, T, is not found in
FT                   cDNA."
FT   misc_difference 2490
FT                   /gene="Slc40a1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2719
FT                   /gene="Slc40a1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2804
FT                   /gene="Slc40a1"
FT                   /note="'T' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2809
FT                   /gene="Slc40a1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 2825
FT                   /gene="Slc40a1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2844
FT                   /gene="Slc40a1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2960
FT                   /gene="Slc40a1"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   misc_difference 3259..3273
FT                   /gene="Slc40a1"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3273 BP; 874 A; 697 C; 730 G; 972 T; 0 other;
     gcgagagcag gctcggggtc tcctgcggcc ggtggatcct ccaacccgct cccataaggc        60
     tttggctttc caacttcagc tacagtgtta gctaagtttg gaaagaagac aaaaagaaga       120
     ccccgtgaca gctttgctgt tgttgtttgc cttagttgtc ctttggggtc tttcggcata       180
     aggctgttgt gcttatagtg gtgctatctt cggttcctct cactcctgtg aacaagctcc       240
     cgggcaagag cagctaaagc taccagcatc agaacaaaca cggggagaac gcctggtgtc       300
     atgaccaagg caagagatca aacccatcag gaaggatgct gtggatcctt agcaaactac       360
     ctgacctcag caaaattcct cctctacctt ggccactctc tctccacttg gggggatcgg       420
     atgtggcact ttgcagtgtc tgtgtttctg gtggaactct atggaaacag ccttctcttg       480
     acagctgtct atggactggt ggtggcaggc tctgttctgg tcctgggagc catcattggt       540
     gactgggtgg ataagaatgc cagacttaaa gtggcccaga cgtcactagt ggttcagaat       600
     gtgtccgtca tcctctgcgg aatcatcctg atgatggttt tcctacacaa gaatgagctc       660
     ctgaccatgt accatggatg ggtccttact gtctgctaca tcctgatcat cactattgca       720
     aacattgcaa atttggccag tactgccact gcgatcacaa tccaaaggga ctggattgtt       780
     gttgtggcag gagaaaacag gagcagatta gcagacatga atgctaccat tagaaggatt       840
     gaccagctaa ccaacatcct ggcccccatg gctgtcggcc agattatgac atttggttct       900
     ccagtcattg gctgtggttt catttccggt tggaatttgg tgtccatgtg tgtggagtac       960
     ttcttgctct ggaaggttta ccagaagacc cctgctctgg ctgtaaaagc tgctctcaag      1020
     gtagaggagt cagaactgaa gcagctgacc tcacctaaag atactgagcc aaaacctttg      1080
     gagggaactc atctaatggg tgagaaagac tccaacatcc gtgaacttga atgtgaacaa      1140
     gagcccacct gtgcctccca gatggcagag cccttccgca ctttccgaga tggatgggtc      1200
     tcctactata accagccagt gtttctggct ggcatgggcc tggctttcct ctatatgaca      1260
     gtcctgggct ttgactgtat cactacaggg tacgcctaca ctcaggggct gagtggatcc      1320
     atccttagta ttttgatggg agcatcagca ataactggaa taatgggaac tgtggccttc      1380
     acctggctac gtcgaaaatg tggccttgtt cggactggtc tattctcagg actagcccag      1440
     ctttcctgtt taatcttgtg tgtgatctcc gtattcatgc ctggaagccc cttggacctg      1500
     tctgtttctc catttgaaga tatccgttct aggtttgtga atgtggagcc agtgtcccca      1560
     actaccaaaa tacctgagac cgtctttaca acagaaatgc atatgtccaa catgtctaat      1620
     gtccatgaga tgagtactaa acccatcccc atagtctctg tcagcctgct gtttgcagga      1680
     gtcattgctg ctagaatcgg tctttggtcc tttgatttga cggtgacaca gttgctgcaa      1740
     gaaaatgtaa ttgaatctga aagaggcatt atcaatggtg tgcagaactc catgaactac      1800
     cttcttgacc ttctgcattt catcatggtc atcttggccc caaatcctga agcttttggc      1860
     ttgctggtat tgatttcagt ctcctttgtg gcaatgggac atcttatgta tttccgattt      1920
     gcccagaaga ctctgggcaa ccagattttt gtttgtggtc ctgatgaaaa agaagttaca      1980
     gatgaaaatc aaccgaatac atctgttgta taaaaatagt ttagctgtgg cccctgttac      2040
     tagattgtgg agagcatgtg tgcttatttt gtactgcaga atcccaataa atgcctgcat      2100
     ttctctctgg ttttaccacc tctgtgcctt aagggctagg agcactaact aaccatcgcc      2160
     agcaaagatg gttatttctc cttacatgta aacatgggaa aataggaaga gggagaggca      2220
     gtcagcgtgt gtatagaaag ggcttaatgg taaaatgaac ttcccttact cttataagta      2280
     tattaaattt tgaagagtgg ttgtcaggtg agtaaaatta ttccttagca gatatttatt      2340
     atctactaga ataataaatc aattcaccct aaaactcact cttgtaaaag tctgccccac      2400
     ttcctttttt aagatcagtg atatttttct cagttacatt acagaaacaa gtttttcctc      2460
     catgtatgaa ggttatagtt agataatgag tgttatcctt attaatccca ttgaacttaa      2520
     ggaatttatt gtatgtggag gatgaaatgt gtaactagac ttgtccaaaa ggttcatgga      2580
     ataacttttg cattttgacc atcagaaagg gcaaaatatt acagtaatgt gtgtatggtg      2640
     gctcttcata aaatgactct caaaatctgc agaaagaaga aaagttgtag gtttctagtg      2700
     tggtacagaa ggacttaagg cttgttatta gtgtgattgt agaaactgga agctaagggt      2760
     gaggacctca tgtaaccaga gtcactgtca tcagccatca ctatctatct tggtaaatga      2820
     gagagctgac ctggcacctt acaggcagaa aagcggccca cactaagaaa ggactgcaaa      2880
     tcagtgagtc tgtatagaac attttacctt cactgacttg ggccgatgtg tttgtcatct      2940
     ctgtgttttt ctagagcaac aatagtcaca aaagttcccc tttcaatatc cctgagaaga      3000
     ataaagaaaa aactgtttgt aaatattttt ttaaaactgt tctgcaagtc tttttgtaac      3060
     atgcagtacc aacatgggac attgccttaa cttttgatgc actttcatgg agactgactg      3120
     ccatgcattg ctgtgagcac tttctttgtc gttcagttta atcttttcct tcacctttat      3180
     tacagtatga cataatgatc tactatgttg tcaaagcttc ataaaatatt tctatataaa      3240
     atgtttgtag aatcttcaaa aaaaaaaaaa aaa                                   3273
//


spacer
spacer