spacer

EBI Dbfetch

ID   BC002297; SV 1; linear; mRNA; STD; MUS; 1731 BP.
XX
AC   BC002297;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus spinster homolog 1 (Drosophila), mRNA (cDNA clone
DE   IMAGE:3590802), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1731
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1731
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JAN-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7381a969f9ef31ecc7e1cbbfb9613dba.
DR   Ensembl-Gn; ENSMUSG00000030741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032994; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 11 Row: a Column: 19.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1731
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="Czech II"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Lu29"
FT                   /clone="IMAGE:3590802"
FT                   /tissue_type="Mammary tumor metastatized to lung. Tumor
FT                   arose spontaneously from a senescent normal mammary
FT                   (clonal) outgrowth infected with the virus MMTV."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1731
FT                   /gene="Spns1"
FT                   /note="synonyms: Spin1, Spinl"
FT   CDS             <1..1463
FT                   /codon_start=3
FT                   /gene="Spns1"
FT                   /product="Spns1 protein"
FT                   /db_xref="GOA:Q8R0G7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1920908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R0G7"
FT                   /protein_id="AAH02297.1"
FT                   /translation="DCEGLQRITGLSRGHSTLIVVVLCYINLLNYMDRFTVAGVLTDIE
FT                   QFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDKYNRKYLMCGGIAFWSLVTLGSSFIP
FT                   REHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIA
FT                   GSKVKDVAGDWHWALRVTPGLGVLAVLLLFLVVQEPPRGAVERHSGSPPLSPTSWWADL
FT                   KALARNPSFVLSSLGFTSVAFVTGSLALWAPAFLLRSRVVLGETPPCLPGDSCSSSDSL
FT                   IFGLITCLTGVLGVGLGVEISRRLRRFNPRADPLVCAAGLLGSAPFLFLALACARGSIV
FT                   ATYIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLI
FT                   SDRLRRSWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAMFIEDDRRRAQLHVQGLL
FT                   HESGPSDDRIVVPQRGRSTRVPVSSVLI"
FT   misc_difference 238
FT                   /gene="Spns1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'K' in cDNA, 'R' in the mouse genome."
FT   misc_difference 566
FT                   /gene="Spns1"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 587
FT                   /gene="Spns1"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 764
FT                   /gene="Spns1"
FT                   /note="'C' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1334
FT                   /gene="Spns1"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1519
FT                   /gene="Spns1"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1716..1731
FT                   /gene="Spns1"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1731 BP; 301 A; 518 C; 490 G; 422 T; 0 other;
     cagactgtga ggggctacag cgcatcactg gcttatctcg gggccattcg accctcatag        60
     tggtggttct gtgctacatt aacctcctga actacatgga ccgcttcacc gtggcagggg       120
     ttcttacaga catcgagcag ttctttaaca tcggagatgg tagtactggc ctcatccaga       180
     ctgtgttcat ctccagttac atggtgttgg caccagtgtt tggctacctg ggtgacaagt       240
     acaatcgaaa gtacctcatg tgcgggggca ttgccttctg gtccctggtg acactgggat       300
     catccttcat ccccagagag catttctggc tgcttctcct gacccggggc ctggtggggg       360
     tcggggaggc cagttactcc accattgcgc ccaccctgat cgccgacctc ttcgtggcag       420
     accagcggag tcggatgctc agtatcttct actttgccat ccctgtgggc agtggtctag       480
     gttacattgc tggctccaaa gtgaaagacg tggctggaga ctggcactgg gctctacggg       540
     tgacaccagg tctaggagtg ctggccgtcc tgctgctgtt cctggtagtc caggagcccc       600
     caagaggagc cgtggagcgc cactcaggtt caccacccct gagccccacc tcttggtggg       660
     cagatctgaa ggcactggca cgaaatccta gtttcgtcct gtcttccctt ggcttcacct       720
     ctgtggcctt tgtcacgggc tccctggctc tctgggcccc agccttcctg ctgcgctccc       780
     gggttgttct gggagagact ccgccctgtc tccctggaga ttcatgctct tcctctgaca       840
     gtctcatctt tggactcatc acttgcctga ctggagtcct gggtgtgggc ctgggagtgg       900
     agatcagccg ccgccttcgc cgcttcaacc ctcgggctga cccactcgtc tgtgcagctg       960
     gcctcctggg ttcggcgcct ttcctcttcc tggccctggc ctgtgcccga ggtagcatcg      1020
     tggccaccta tatttttatc tttattgggg agaccctgtt gtccatgaac tgggccattg      1080
     tggctgacat cctgttgtac gtggtgatcc caactcgacg gtccacggct gaggccttcc      1140
     agatagtgct gtcccacttg ctaggagatg cagggagccc ttacctcatt ggtctaatct      1200
     ctgaccgcct ccgacggagc tggccccctt ccttcctgtc cgagttccgg gctctgcagt      1260
     tctcgctcat gctctgtgct ttcgttgggg cactgggtgg tgcggccttc ctgggcaccg      1320
     ccatgttcat tgaggatgac cgccggcggg ctcaactcca cgtgcagggt ctgttgcatg      1380
     agtctgggcc ctcagatgac cggattgtag tacctcagcg aggccgttct acccgagtcc      1440
     ccgtgtccag cgtgctcatc tgaggagccg gtgcttaccc ggccactgat gcatcgcagc      1500
     tgggccttgg gcccacccca gacggttccc aggcagaagc cctcaccagg cccaggtcca      1560
     agaaggaagc cctgggatat ctcccagctc ccagacacta catgggcagc ccagggaaga      1620
     gatgggagtc cagaaacggg gaaggggtgt cctctctact aggacagccc aaggggtttg      1680
     gtgctatttg taatggaata aaatttgtaa tcagaaaaaa aaaaaaaaaa a               1731
//


spacer
spacer