spacer

EBI Dbfetch

ID   BC002141; SV 1; linear; mRNA; STD; MUS; 1362 BP.
XX
AC   BC002141;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 18)
XX
DE   Mus musculus lipoic acid synthetase, mRNA (cDNA clone MGC:7254
DE   IMAGE:3484559), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1362
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1362
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JAN-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; cf696349b1491f4871037b07314babba.
DR   Ensembl-Gn; ENSMUSG00000029199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031101; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 7 Row: g Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981391.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1362
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:7254 IMAGE:3484559"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1362
FT                   /gene="Lias"
FT                   /note="synonyms: MGC7254, mLip1"
FT   CDS             65..1186
FT                   /codon_start=1
FT                   /gene="Lias"
FT                   /product="lipoic acid synthetase"
FT                   /db_xref="GOA:Q99M04"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="MGI:MGI:1934604"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99M04"
FT                   /protein_id="AAH02141.1"
FT                   /translation="MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQ
FT                   DFVSGDLADKSTWDEYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTV
FT                   CEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTA
FT                   KAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAV
FT                   EKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGL
FT                   GETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFL
FT                   YTASGPLVRSSYKAGEFFLKNLVARRKTKASKV"
FT   misc_difference 1357..1362
FT                   /gene="Lias"
FT                   /note="polyA tail: 6 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1362 BP; 389 A; 286 C; 372 G; 315 T; 0 other;
     gcgtccggtg ccgggggtgc tgttccctcg atcccttgac actcctgaga cctaaaagag        60
     ggggatggct ctacgctgct gggatacagc tcgcagcctg gggtcccgga tatttggaag       120
     atatgcgttc acggttagag cattaagttc tttgccagat aagaaaaagg aatttttgca       180
     taatggacca gaccttcaag attttgtatc tggtgatctt gcagacaaga gtacatggga       240
     tgaatataaa ggaaacttaa agcgccagaa aggagaaagg ctaagactac ctccatggct       300
     aaagacaaag atacccatgg gtaaaaacta caataaactg aaaaatacat tgcggaattt       360
     aagtctccac acagtgtgtg aggaagcccg gtgccccaac attggagagt gttggggagg       420
     tggggaatat gccacagcca cagccacgat catgttgatg ggggacacat gcacaagagg       480
     ttgcagattt tgttccgtta agaccgcaag aaatccccct ccattggatg ccaatgagcc       540
     cgacaatacg gccaaagcaa ttgcagagtg gggtctggat tatgttgtcc tgacgtcggt       600
     ggatcgagat gatgtggccg acgggggagc tgagcacatc gccaagaccg tgtcatgctt       660
     gaaggaaagg aatccaaaaa tcctcgtgga atgcctcacc ccagacttcc gaggtgatct       720
     gagagcagtg gagaaggtgg ctctgtctgg attagatgtg tatgcacaca atgtggagac       780
     tgtccccgag ttacagagga aagttcgtga tccccgggcc aattttgacc agtctcttcg       840
     tgtactgaga catgccaagg aggtccagcc tgatgttgtt tccaaaacat cgataatgct       900
     gggccttggt gagacagacg agcaagtcta tgccacactg aaagctctcc gtgcggccga       960
     cgtggactgt ttaactctag ggcagtacat gcagccaacg aagcgccacc ttaaggttga      1020
     agaatatgtt actcctgaga agttcaaata ctgggaaaaa gtagggaatg aacttggatt      1080
     tctctatacg gcaagtggtc ctttggtgcg atcttcatat aaagcaggtg aatttttcct      1140
     gaaaaatcta gtggctagaa gaaaaacaaa agcttctaaa gtgtagccaa gcccttcaag      1200
     atcacaggag tgttgcgatt ttgcttccag ttggtgtgag gatggtgtca ccctgtcagg      1260
     attcctgtga gtgcaaggca gcaccgttct gaagggtctg atggctgatc gaagcggaat      1320
     ggtgtatacc tgtaattcca cccaggaaaa aaaaaaaaaa aa                         1362
//


spacer
spacer