Dbfetch

ID   BC002126; SV 1; linear; mRNA; STD; MUS; 924 BP.
XX
AC   BC002126;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 22)
XX
DE   Mus musculus gamma-aminobutyric acid receptor associated protein, mRNA
DE   (cDNA clone MGC:6656 IMAGE:3497484), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-924
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-924
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JAN-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7c395606c68ec2f3d34a70904b8108de.
DR   Ensembl-Gn; ENSMUSG00000018567; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018575; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018543; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018512; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018515; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018328; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018966; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017883; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018300; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018410; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018400; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018480; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018423; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019008; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017657; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017937; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000018711; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030169; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030108; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030082; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030101; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029897; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030603; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029597; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029814; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029952; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029943; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030067; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029927; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030631; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029314; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029389; mus_musculus_wsbeij.
DR   EuropePMC; PMC1553470; 16822311.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 8 Row: f Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254379.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..924
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:6656 IMAGE:3497484"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..924
FT                   /gene="Gabarap"
FT   CDS             107..460
FT                   /codon_start=1
FT                   /gene="Gabarap"
FT                   /product="gamma-aminobutyric acid receptor associated
FT                   protein"
FT                   /db_xref="GOA:Q9DCD6"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1861742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCD6"
FT                   /protein_id="AAH02126.1"
FT                   /translation="MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD
FT                   KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFF
FT                   LYIAYSDESVYGL"
FT   misc_difference 888..924
FT                   /gene="Gabarap"
FT                   /note="polyA tail: 37 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 924 BP; 236 A; 249 C; 207 G; 232 T; 0 other;
     gctccgccaa gtctgttcgt cgaagccgcc tccgccgccg ccccctgtcc cggccccccc        60
     cctgggttcc ctcagcccag ctcggtccag cccggttctc gggagaatga agttcgtgta       120
     caaagaggag catccgttcg agaagcgccg ctctgagggc gagaaaatcc gaaagaaata       180
     cccagaccgg gtcccggtga tagtggaaaa agcccccaaa gctcggatag gagacctgga       240
     caaaaagaaa tacctggtgc cttctgatct tacagttggt caattctact tcttgatccg       300
     gaagcgaatt catctccgtg ctgaagatgc cttgtttttc tttgtcaaca atgtcattcc       360
     acccaccagt gccacgatgg gtcagctgta ccaggaacac catgaagaag acttctttct       420
     atacattgcc tacagtgatg aaagcgtcta tggtctgtga agctgctgta cctgaggtgg       480
     ggggttccat tctacgaaga gaggtggcgc tccttccttg acatccagtt cctccttcag       540
     gctcaaacac cacctccttt cttcaggacc tgcacttaat gtttgaggct gtctctccag       600
     tccctctcag caggaggggt aatggtagat acagcctcca tacatctctt tctccccttg       660
     tttaccctcc attcccactc tgatttagac ttcttgattg tcgatctctg tcacatccga       720
     tgattgtttt ggtttctatt ccctttctaa ctgcccatcg ggctcagaac cccaataatc       780
     ccttcctttc actatcttct ttttgggggg taggtggaag ggattgacat tggatggggg       840
     aggtaggagg cacatcaata aaaaggaaac caccgagctg aattgaaaaa aaaaaaaaaa       900
     aaaaaaaaaa aaaaaaaaaa aaaa                                              924
//