spacer

EBI Dbfetch

ID   BC002000; SV 1; linear; mRNA; STD; MUS; 1595 BP.
XX
AC   BC002000;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 12)
XX
DE   Mus musculus sigma non-opioid intracellular receptor 1, mRNA (cDNA clone
DE   MGC:5760 IMAGE:3484605), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1595
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1595
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (31-JAN-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d8c75bce903b33e092a417017c0abef3.
DR   Ensembl-Gn; ENSMUSG00000036078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071561; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 7 Row: e Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6754941.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 37) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1595
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:5760 IMAGE:3484605"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1595
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT   CDS             57..728
FT                   /codon_start=1
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT                   /product="Sigmar1 protein"
FT                   /db_xref="GOA:O55242"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="InterPro:IPR028545"
FT                   /db_xref="MGI:MGI:1195268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55242"
FT                   /protein_id="AAH02000.1"
FT                   /translation="MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQL
FT                   ARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYV
FT                   LLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALE
FT                   WGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQD
FT                   S"
FT   misc_difference 769^770
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT                   /note="1 base in the mouse genome, C, is not found in
FT                   cDNA."
FT   misc_difference 1298^1299
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT                   /note="4 bases in the mouse genome, CCCC, are not found in
FT                   cDNA."
FT   misc_difference 1582..1595
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1595 BP; 361 A; 447 C; 418 G; 369 T; 0 other;
     cacagcctgt ggccctagtt cggtcttacg ttggtggtgc caggctgccc gctagaatgc        60
     cgtgggccgc gggacggcgg tgggcatgga tcaccctgat tctgactatt atcgcagtgc       120
     tgatccaggc cgcctggttg tggctgggca ctcaaaactt cgtcttctct agagaagaaa       180
     tagcgcagct tgctcgacag tatgcggggc tggaccatga gcttgccttc tctcggctga       240
     tcgtggagct gcggaggctg cacccaggcc acgtgctgcc ggatgaggag ctgcagtggg       300
     tatttgtgaa cgcgggcggc tggatgggcg ccatgtgtat tctgcacgcc tcgctgtctg       360
     agtacgtgct gctcttcggc accgccctgg gctcccatgg ccattcggga cgatactggg       420
     ctgagatttc tgacaccatc atctctggca ccttccacca atggaaagag ggcaccacga       480
     aaagtgaggt cttctaccca ggagagacag ttgtacacgg gcctggagaa gcaacggctc       540
     tggagtgggg accaaacacg tggatggtgg agtacggccg gggtgttatt ccgtctaccc       600
     tgttctttgc actagccgac actttcttca gcacccagga ctacctcaca ctcttctata       660
     cccttcgggc ctatgcccgg ggcctccggc ttgagcttac cacctacctc tttggccaag       720
     actcctgacc agccaggcct gaaggaagat ctgtggatgg acaggagcgg gcaggaccac       780
     atccatctct ctactcgctg gaactcatat tcagacagca gcgtatacca tgcagatatt       840
     aagtacctgc tgtatgagga aggacataca tacttgtaca tccagacaca gctcttggga       900
     agcaaatgag acacagagat gctaagactt gtatgtactg taagatcatg cactcacatc       960
     cacccagaaa gggtcctcta catatactcc agggggccag tcatgtttga acacacatca      1020
     caagcttgac tcactgactc aggctttcct agagcctcct gctggcattc agggctctgg      1080
     gatcaagggt tgaggtagat gttacacact acctcactct gatgcctcat tcctgtagta      1140
     atctctggtg aagggaaaga ggagctgccc ttcggaggtc cccttcacct gcagctatga      1200
     tgcccttccc ttcatccctt tcctcaccat atgccttatc tccattccac tcccctgcta      1260
     tgcaaatgcc cccctggctt gtcctccctg ccccccccgg caaccagttc agctgggaaa      1320
     gcagaggcat gtagaggatg ctaaagggaa gggaggtcct ccactacgga gacccttgtt      1380
     ggggttagaa tgggaaagct ggctagtgcc ccagggccag ttcccaagga gaggacctgg      1440
     agaagtaagc cggggtccaa ggagccaccc cattccaaaa gaagccttta gtgtgtgtgt      1500
     gcacacccta tcagtttcca gacatatctg ttgcaatctc tgtcttcttg tctctctctg      1560
     ttaataaaaa catattaaac aaaaaaaaaa aaaaa                                 1595
//


spacer
spacer