spacer

EBI Dbfetch

ID   BC001275; SV 1; linear; mRNA; STD; HUM; 1408 BP.
XX
AC   BC001275;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens annexin A1, mRNA (cDNA clone MGC:5095 IMAGE:3459615), complete
DE   cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1408
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1408
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (11-DEC-2000) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 686304fb0d379f087a54856e23569e3e.
DR   Ensembl-Gn; ENSG00000135046; homo_sapiens.
DR   Ensembl-Tr; ENST00000257497; homo_sapiens.
DR   Ensembl-Tr; ENST00000376911; homo_sapiens.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: ATCC
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 4 Row: g Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 4502100.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1408
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_12"
FT                   /clone="MGC:5095 IMAGE:3459615"
FT                   /tissue_type="Cervix, carcinoma"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1408
FT                   /gene="ANXA1"
FT   CDS             53..1093
FT                   /codon_start=1
FT                   /gene="ANXA1"
FT                   /product="annexin A1"
FT                   /db_xref="GOA:P04083"
FT                   /db_xref="H-InvDB:HIT000030281.16"
FT                   /db_xref="HGNC:HGNC:533"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR002388"
FT                   /db_xref="InterPro:IPR018252"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="PDB:1AIN"
FT                   /db_xref="PDB:1BO9"
FT                   /db_xref="PDB:1QLS"
FT                   /protein_id="AAH01275.1"
FT                   /translation="MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPS
FT                   SDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGKPLDETLKKALTGHL
FT                   EEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEILASRTNKEIRDINRVYREELKRD
FT                   LAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFN
FT                   TILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEK
FT                   LHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILV
FT                   ALCGGN"
FT   misc_difference 1380..1408
FT                   /gene="ANXA1"
FT                   /note="polyA tail: 29 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1408 BP; 486 A; 271 C; 293 G; 358 T; 0 other;
     atttctcttt agttctttgc aagaaggtag agataaagac actttttcaa aaatggcaat        60
     ggtatcagaa ttcctcaagc aggcctggtt tattgaaaat gaagagcagg aatatgttca       120
     aactgtgaag tcatccaaag gtggtcccgg atcagcggtg agcccctatc ctaccttcaa       180
     tccatcctcg gatgtcgctg ccttgcataa ggccataatg gttaaaggtg tggatgaagc       240
     aaccatcatt gacattctaa ctaagcgaaa caatgcacag cgtcaacaga tcaaagcagc       300
     atatctccag gaaacaggaa agcccctgga tgaaacactg aagaaagccc ttacaggtca       360
     ccttgaggag gttgttttag ctctgctaaa aactccagcg caatttgatg ctgatgaact       420
     tcgtgctgcc atgaagggcc ttggaactga tgaagatact ctaattgaga ttttggcatc       480
     aagaactaac aaagaaatca gagacattaa cagggtctac agagaggaac tgaagagaga       540
     tctggccaaa gacataacct cagacacatc tggagatttt cggaacgctt tgctttctct       600
     tgctaagggt gaccgatctg aggactttgg tgtgaatgaa gacttggctg attcagatgc       660
     cagggccttg tatgaagcag gagaaaggag aaaggggaca gacgtaaacg tgttcaatac       720
     catccttacc accagaagct atccacaact tcgcagagtg tttcagaaat acaccaagta       780
     cagtaagcat gacatgaaca aagttctgga cctggagttg aaaggtgaca ttgagaaatg       840
     cctcacagct atcgtgaagt gcgccacaag caaaccagct ttctttgcag agaagcttca       900
     tcaagccatg aaaggtgttg gaactcgcca taaggcattg atcaggatta tggtttcccg       960
     ttctgaaatt gacatgaatg atatcaaagc attctatcag aagatgtatg gtatctccct      1020
     ttgccaagcc atcctggatg aaaccaaagg agattatgag aaaatcctgg tggctctttg      1080
     tggaggaaac taaacattcc cttgatggtc tcaagctatg atcagaagac tttaattata      1140
     tattttcatc ctataagctt aaataggaaa gtttcttcaa caggattaca gtgtagctac      1200
     ctacatgctg aaaaatatag cctttaaatc atttttatat tataactctg tataatagag      1260
     ataagtccat tttttaaaaa tgttttcccc aaaccataaa accctataca agttgttcta      1320
     gtaacaatac atgagaaaga tgtctatgta gctgaaaata aaatgacgtc acaagacaaa      1380
     aaaaaaaaaa aaaaaaaaaa aaaaaaaa                                         1408
//


spacer
spacer