Dbfetch

ID   BC000332; SV 2; linear; mRNA; STD; HUM; 1110 BP.
XX
AC   BC000332;
XX
DT   09-MAR-2001 (Rel. 67, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Homo sapiens ubiquitin carboxyl-terminal esterase L1 (ubiquitin
DE   thiolesterase), mRNA (cDNA clone MGC:8524 IMAGE:2822541), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1110
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1110
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (15-NOV-2000) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; ca9b1ddacc56639d57c081fb6bc84643.
DR   Ensembl-Gn; ENSG00000154277; homo_sapiens.
DR   Ensembl-Tr; ENST00000284440; homo_sapiens.
DR   Ensembl-Tr; ENST00000503431; homo_sapiens.
DR   EuropePMC; PMC1637111; 17090317.
XX
CC   On Aug 19, 2003 this sequence version replaced gi:12653130.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: DCTD/DTP
CC   cDNA Library Preparation: Rubin Laboratory
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAL Plate: 1 Row: i Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34147658.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B-R"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_7"
FT                   /clone="MGC:8524 IMAGE:2822541"
FT                   /tissue_type="Lung, small cell carcinoma"
FT                   /note="Vector: pOTB7"
FT                   /db_xref="taxon:9606"
FT   gene            1..1110
FT                   /gene="UCHL1"
FT                   /note="synonym: PGP9.5"
FT   CDS             66..737
FT                   /codon_start=1
FT                   /gene="UCHL1"
FT                   /product="ubiquitin carboxyl-terminal esterase L1
FT                   (ubiquitin thiolesterase)"
FT                   /db_xref="GOA:P09936"
FT                   /db_xref="H-InvDB:HIT000029526.18"
FT                   /db_xref="HGNC:HGNC:12513"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="PDB:2ETL"
FT                   /db_xref="PDB:2LEN"
FT                   /db_xref="PDB:3IFW"
FT                   /db_xref="PDB:3IRT"
FT                   /db_xref="PDB:3KVF"
FT                   /db_xref="PDB:3KW5"
FT                   /db_xref="PDB:4DM9"
FT                   /db_xref="PDB:4JKJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P09936"
FT                   /protein_id="AAH00332.1"
FT                   /translation="MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLEEESLGSVPAP
FT                   ACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQD
FT                   KLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFI
FT                   LFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKA
FT                   A"
FT   misc_difference 1094..1110
FT                   /gene="UCHL1"
FT                   /note="polyA tail: 17 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1110 BP; 282 A; 270 C; 285 G; 273 T; 0 other;
     cctgggcggc tccgctagct gtttttcgtc ttccctaggc tatttctgcc gggcgctccg        60
     cgaagatgca gctcaagccg atggagatca accccgagat gctgaacaaa gtgctgtccc       120
     ggctgggggt cgccggccag tggcgcttcg tggacgtgct ggggctggaa gaggagtctc       180
     tgggctcggt gccagcgcct gcctgcgcgc tgctgctgct gtttcccctc acggcccagc       240
     atgagaactt caggaaaaag cagattgaag agctgaaggg acaagaagtt agtcctaaag       300
     tgtacttcat gaagcagacc attgggaatt cctgtggcac aatcggactt attcacgcag       360
     tggccaataa tcaagacaaa ctgggatttg aggatggatc agttctgaaa cagtttcttt       420
     ctgaaacaga gaaaatgtcc cctgaagaca gagcaaaatg ctttgaaaag aatgaggcca       480
     tacaggcagc ccatgatgcc gtggcacagg aaggccaatg tcgggtagat gacaaggtga       540
     atttccattt tattctgttt aacaacgtgg atggccacct ctatgaactt gatggacgaa       600
     tgccttttcc ggtgaaccat ggcgccagtt cagaggacac cctgctgaag gacgctgcca       660
     aggtctgcag agaattcacc gagcgtgagc aaggagaagt ccgcttctct gccgtggctc       720
     tctgcaaggc agcctaatgc tctgtgggag ggactttgct gatttcccct cttcccttca       780
     acatgaaaat atataccccc ccatgcagtc taaaatgctt cagtacttgt gaaacacagc       840
     tgttcttctg ttctgcagac acgccttccc ctcagccaca cccaggcact taagcacaag       900
     cagagtgcac agctgtccac tgggccattg tggtgtgagc ttcagatggt gaagcattct       960
     ccccagtgta tgtcttgtat ccgatatcta acgctttaaa tggctacttt ggtttctgtc      1020
     tgtaagttaa gaccttggat gtggtttaat tgtttgtcct caaaaggaat aaaacttttc      1080
     tgctgataag ataaaaaaaa aaaaaaaaaa                                       1110
//