spacer

EBI Dbfetch

ID   AY999074; SV 1; linear; genomic DNA; STD; HUM; 1051 BP.
XX
AC   AY999074;
XX
DT   15-MAY-2005 (Rel. 83, Created)
DT   08-OCT-2005 (Rel. 85, Last updated, Version 2)
XX
DE   Homo sapiens isolate BY84 MHC class II antigen (HLA-DQB1) gene,
DE   HLA-DQB1*0602 allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1051
RX   DOI; 10.1007/s00251-005-0017-x.
RX   PUBMED; 16078082.
RA   Xu Y., Hu Q., Liu Z., Shen Y., Liu X., Lin B., Wu Y., Chen S., Xu A.;
RT   "Sequence variations in the transcriptional regulatory region and intron1
RT   of HLA-DQB1 gene and their linkage in southern Chinese ethnic groups";
RL   Immunogenetics 57(7):465-478(2005).
XX
RN   [2]
RP   1-1051
RA   Xu A., Liu Z., Liu X.;
RT   ;
RL   Submitted (05-APR-2005) to the INSDC.
RL   Life Science School, Sun Yat-Sen, Xin Gang Xi, Guangzhou, Guangdong 510275,
RL   China
XX
DR   MD5; 745f91f53a39d4e2fc0f5bb3ae4bd692.
DR   EPD; EP16068; HS_HLA-DQB1.
DR   Ensembl-Gn; ENSG00000179344; homo_sapiens.
DR   Ensembl-Tr; ENST00000374943; homo_sapiens.
DR   Ensembl-Tr; ENST00000399079; homo_sapiens.
DR   Ensembl-Tr; ENST00000399082; homo_sapiens.
DR   Ensembl-Tr; ENST00000399084; homo_sapiens.
DR   Ensembl-Tr; ENST00000434651; homo_sapiens.
DR   Ensembl-Tr; ENST00000484729; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1051
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="BY84"
FT                   /mol_type="genomic DNA"
FT                   /country="China"
FT                   /tissue_type="peripheral blood"
FT                   /note="Buyi ethnic group"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1051
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT   mRNA            <1..>457
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /product="MHC class II antigen"
FT   5'UTR           <1..348
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT   CDS             <349..>457
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /product="MHC class II antigen"
FT                   /note="glycoprotein; human leucocyte antigen"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VC55"
FT                   /protein_id="AAY33733.1"
FT                   /translation="MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSP"
XX
SQ   Sequence 1051 BP; 258 A; 231 C; 267 G; 295 T; 0 other;
     tgtttactgt tgaatcgcat ttttttcttt tgcctctcaa aatccccgag gcattcgttc        60
     ttcagctctt ctataatcga gaggaaattt tcacctcaga tgttcatcca gtacaatttg       120
     aagacgtcac agtgccaggc actggattga gaaccttcac aaaaaaaatg tctgcccaga       180
     gacagatgag gtccttcagc tccagtgctg attggttctt ttccgaggga ccatccaatc       240
     ctgccactca cggaaacatc cacaggtttt tattctttct gccaggtaca tcagatccat       300
     caggtccgag ctgtgttgac taccactgct tttcccttcg tctcagttat gtcttggaag       360
     aaggctttgc ggatccccgg agaccttcgg gtagcaactg tcaccttgat gctggcgatg       420
     ctgagctccc tactggctga gggcagagac tctcccggta agtgcagggc agctgctctc       480
     cagagccgcc actctgggaa caggctctcc ttgggctggg gtatggggga tggtgatctc       540
     tatgatcttg gacacaatct ttcatcaaca tttcctctct cttgggaaag aaagctatgt       600
     tgcattccca tttatctttt agtgatgaga tgaggacaat ccaatcccca tcctacaggc       660
     ttaagcctgg aagaggagga gagaggagag aaagaggaga taaagtgtac atttactacc       720
     agcgatagga caaagtgagc atggggttat ttttgaagat atgaatttct ccaaagacac       780
     agcaggattt gtcatttagg cgtgccccaa gactgcctgg acttaggatt atgagatcct       840
     gcattggaaa atgtgaggca gcaatggtgt ctgtagtctc tgtatttgag gaaaatttgt       900
     ctctattcct gaccgagtgg agcatttgtg gaggcaaaat cttggtgctg agggaagctg       960
     actggctgac cacagagagg gagtcttcgg gtttcactga tttatgggca aatggtgact      1020
     tgagtgggat tcagataccc gagttgatga t                                     1051
//


spacer
spacer