spacer

EBI Dbfetch

ID   AY963802; SV 1; linear; mRNA; STD; MUS; 386 BP.
XX
AC   AY963802;
XX
DT   01-APR-2006 (Rel. 87, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus perinatal myosin heavy chain (Myh8) mRNA, 5' UTR and partial
DE   cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-386
RA   Dennehey B.K., Leinwand L.A., Krauter K.S.;
RT   "Diversity in Transcriptional Start Site Selection and Alternative Splicing
RT   Affects the 5' UTR of Mouse Striated Muscle Myosin Transcripts";
RL   Unpublished.
XX
RN   [2]
RP   1-386
RA   Dennehey B.K., Krauter K.S.;
RT   ;
RL   Submitted (16-MAR-2005) to the INSDC.
RL   Molecular, Cellular and Developmental Biology, University of Colorado at
RL   Boulder, CB 347, Boulder, CO 80309, USA
XX
DR   MD5; 62e4264adc2417b799e1f63888ef4fc7.
DR   Ensembl-Gn; ENSMUSG00000055775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108685; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..386
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="between MYH4 and MYH13"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo (15-17 dpc)"
FT                   /db_xref="taxon:10090"
FT   gene            1..>386
FT                   /gene="Myh8"
FT   5'UTR           1..94
FT                   /gene="Myh8"
FT   CDS             95..>386
FT                   /codon_start=1
FT                   /gene="Myh8"
FT                   /product="perinatal myosin heavy chain"
FT                   /note="similar to GenBank Accession Numbers AK087387,
FT                   AK081482, and AK029328; transcript variant 1; alternatively
FT                   spliced"
FT                   /db_xref="GOA:Q1WNQ0"
FT                   /db_xref="InterPro:IPR004009"
FT                   /db_xref="InterPro:IPR008989"
FT                   /db_xref="MGI:MGI:1339712"
FT                   /db_xref="UniProtKB/TrEMBL:Q1WNQ0"
FT                   /protein_id="AAY42748.1"
FT                   /translation="MSAGSDAEMAIFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEP
FT                   KESYVKSVIQSKDGGKVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMT"
XX
SQ   Sequence 386 BP; 116 A; 90 C; 104 G; 76 T; 0 other;
     atctccgcca agagcccaga gtgaaggaca ggcgtgactc tacgttttca tccagagctc        60
     catagctgaa acctcggcta aataagtagc agccatgagt gcgggttcgg acgcggagat       120
     ggctattttt ggcgaagctg ctccttacct ccgaaaatcg gagaaggaga ggattgaggc       180
     ccaaaataag ccttttgacg caaaaacatc tgtctttgtg gcggagccca aggagtctta       240
     tgtgaaaagc gttatacaaa gcaaggatgg agggaaagtg accgtgaaga cggaaagtgg       300
     agcaactctc accgtcaagg aagatcaagt cttccccatg aaccctccca aatatgacaa       360
     gatcgaggac atggccatga tgaccc                                            386
//


spacer
spacer