Dbfetch

ID   AY963587; SV 1; linear; genomic DNA; STD; HUM; 338 BP.
XX
AC   AY963587;
XX
DT   27-MAR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*13 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-338
RX   DOI; 10.1111/j.1399-0039.2005.00451.x.
RX   PUBMED; 16101838.
RA   Caggiari L., Simula M.P., Marzotto A., Caragnano A., Luchetti M.,
RA   Gabrielli A., De Re V.;
RT   "Identification of a novel human DRB1*13 allele by sequence-based DRB
RT   typing";
RL   Tissue Antigens 66(3):246-247(2005).
XX
RN   [2]
RP   1-338
RA   De Re V., Caggiari L.;
RT   ;
RL   Submitted (16-MAR-2005) to the INSDC.
RL   OS1, CRO, Pedemontana, Aviano, PN 33081, Italy
XX
DR   MD5; 12038cf790c104fb2630a33e4ef0bd39.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..338
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <23..>292
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT   mRNA            <23..>292
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <23..>292
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:68"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAX51706.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEDVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            23..292
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /number=2
XX
SQ   Sequence 338 BP; 65 A; 83 C; 127 G; 63 T; 0 other;
     tggatcgttc gtgtccccac agcacgtttc ttggagtact ctacgtctga gtgtcatttc        60
     ttcaatggga cggagcgggt gcggttcctg gacagatact tccataacca ggaggaggac       120
     gtgcgcttcg acagcgacgt gggggagttc cgggcggtga cggagctggg gcggcctgat       180
     gccgagtact ggaacagcca gaaggacatc ctggaagacg agcgggccgc ggtggacacc       240
     tactgcagac acaactacgg ggttgtggag agcttcacag tgcagcggcg aggtgagcgc       300
     ggcgcggggc ggggcctgag tccctgtgag ctgggaat                               338
//