spacer

EBI Dbfetch

ID   AY942546; SV 1; linear; genomic DNA; STD; FUN; 1218 BP.
XX
AC   AY942546;
XX
DT   28-JUN-2005 (Rel. 84, Created)
DT   04-AUG-2005 (Rel. 84, Last updated, Version 2)
XX
DE   Saccharomyces cerevisiae strain YJM320 cytochrome c1 (CYT1) gene, partial
DE   cds.
XX
KW   .
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RP   1-1218
RX   DOI; 10.1371/journal.pgen.0010005.
RX   PUBMED; 16103919.
RA   Fay J.C., Benavides J.A.;
RT   "Evidence for Domesticated and Wild Populations of Saccharomyces
RT   cerevisiae";
RL   PloS Genet. 1(1):e5-e5(2005).
XX
RN   [2]
RP   1-1218
RA   Fay J.C., Benavides J.A.;
RT   ;
RL   Submitted (23-FEB-2005) to the INSDC.
RL   Genetics, Washington University, 4566 Scott Ave, St. Louis, MO 63110, USA
XX
DR   MD5; 56da117075cf63b8b7d3cc5c0bab8574.
DR   Ensembl-Gn; YOR065W; saccharomyces_cerevisiae.
DR   Ensembl-Tr; YOR065W; saccharomyces_cerevisiae.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1218
FT                   /organism="Saccharomyces cerevisiae"
FT                   /strain="YJM320"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:4932"
FT   gene            <611..>1218
FT                   /gene="CYT1"
FT   mRNA            <611..>1218
FT                   /gene="CYT1"
FT                   /product="cytochrome c1"
FT   CDS             611..>1218
FT                   /codon_start=1
FT                   /gene="CYT1"
FT                   /product="cytochrome c1"
FT                   /db_xref="GOA:Q4KPK3"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KPK3"
FT                   /protein_id="AAY22938.1"
FT                   /translation="MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAG
FT                   ITASTLLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAAC
FT                   HSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQ
FT                   AARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPP"
XX
SQ   Sequence 1218 BP; 341 A; 255 C; 244 G; 378 T; 0 other;
     gatgttctgt gagccaatcc caaatgtttg tataaggacg gaaataagac ggagcgccac        60
     gtgactgaag attttttttt tctcggattt cttggtaatg ggcggccggt atttccggcg       120
     gccaaaaaat gcgaggattt ggttggtgga gagggtcgag cgcctttacc ctgcgtagat       180
     actaaggggg ctctttctag tatataaaca atttgaataa taacgaggtt agacgtccaa       240
     ctggatccat agactatcta agcttttagt agaggccatt cgttttctta ttaatcatcg       300
     gtttcacaat ctttctttgt taagcaacat tttatacatt tttgtacttt atcttcaaat       360
     attaaggaca agaaagaaaa agaaaaagaa tccatattct atattagtgt aacactattt       420
     ttcttaaata ttttttccag tactccccca gtttgataaa aagcattcat tgaatttccc       480
     cacatttgtg atatcttcaa ttgattagtt tgaactagtt ctgaaaaata atactttaca       540
     atttgcattt tcattacact atatcatcta ctattttttc tcagaagcgg aagttataac       600
     taatttgaca atgttttcaa atctatctaa acgttgggct caaaggaccc tctcgaaaag       660
     tttctactct accgcaacag gtgctgctag taaatctggc aagcttactc aaaagctcgt       720
     tacagcgggt gttgctgccg ccggtatcac cgcatcgact ttactctatg cagactcctt       780
     aactgccgaa gctatgaccg cagctgaaca cggattgcac gccccagcat atgcttggtc       840
     ccacaatggg ccttttgaaa catttgatca tgcatccatt agaagaggtt accaggttta       900
     ccgtgaagtt tgtgccgcct gccattctct tgacagagtt gcttggagaa ctttggttgg       960
     tgtttctcat accaacgaag aggttcgtaa tatggccgaa gaatttgaat acgatgacga      1020
     acctgatgag caaggtaacc ctaaaaagag accaggtaag ttgtccgatt acatccctgg      1080
     cccataccca aacgaacagg ctgcaagagc tgctaatcaa ggtgccttgc cacctgatct      1140
     atctttgatc gtgaaagcta gacacggtgg ttgtgactac attttctctt tgttgaccgg      1200
     ttatcctgat gaacctcc                                                    1218
//


spacer
spacer