spacer

EBI Dbfetch

ID   AY912074; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY912074;
XX
DT   28-SEP-2005 (Rel. 85, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1-DRB1*16 variant
DE   allele, exon and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2005.00443.x.
RX   PUBMED; 16101839.
RA   Miao K.R., Pan Q.Q., Xue M., Zhou X.Y., Fei X.M., Tang Y.H., Xu R.,
RA   Zhang J.W., Zhao X., Osowski L., Shi W.X., Xu A.L., Wang C.Y., KuKuruga D.;
RT   "A novel HLA allele, DRB1*1609, identified in the Chinese Han population*";
RL   Tissue Antigens 66(3):248-250(2005).
XX
RN   [2]
RP   1-270
RA   Wang C., Miao K.;
RT   ;
RL   Submitted (28-JAN-2005) to the INSDC.
RL   HLA Lab, The First Affiliated Hospital of Naning Medical University,
RL   P.R.China, 300 Guangzhou Road, Nanjing, Jiangsu 210029, People Republic of
RL   China
XX
DR   MD5; 3338f184c66ac66893a169761d4d206e.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*16 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*16 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*16 variant"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DR antigen"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*16:09:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="AAY17287.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*16 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 66 C; 99 G; 49 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer