spacer

EBI Dbfetch

ID   AY902323; SV 1; linear; genomic DNA; STD; MUS; 3573 BP.
XX
AC   AY902323;
XX
DT   22-JAN-2006 (Rel. 86, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus strain CAST/EiJ Plcb1 (Plcb1) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3573
RA   Farber C.R., Corva P.M., Medrano J.F.;
RT   "Characterization of quantitative trait loci influencing growth and
RT   adiposity using congenic mouse strains";
RL   Unpublished.
XX
RN   [2]
RP   1-3573
RA   Farber C.R., Medrano J.F.;
RT   ;
RL   Submitted (24-JAN-2005) to the INSDC.
RL   Animal Science, University of California, Davis, One Shields Ave., Davis,
RL   CA 95616, USA
XX
DR   MD5; 360ef85a09070274d68094c70bef7cfd.
DR   Ensembl-Gn; ENSMUSG00000051177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110116; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3573
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="134.9 Mbp"
FT                   /strain="CAST/EiJ"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>3573
FT                   /gene="Plcb1"
FT   5'UTR           <1..100
FT                   /gene="Plcb1"
FT   CDS             101..>3573
FT                   /codon_start=1
FT                   /gene="Plcb1"
FT                   /product="Plcb1"
FT                   /db_xref="GOA:Q2M4J2"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR009535"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014815"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="InterPro:IPR016280"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR028400"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M4J2"
FT                   /protein_id="AAX90608.1"
FT                   /translation="MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRT
FT                   DPQGFFFYWTDQNKETELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMIT
FT                   VVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQV
FT                   TPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPR
FT                   PEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
FT                   SSLAKKGQMSVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQL
FT                   AGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECA
FT                   FKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDL
FT                   MYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDD
FT                   DDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGL
FT                   EQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQI
FT                   NMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVG
FT                   TYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEG
FT                   GKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSN
FT                   PIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETSSEAPSETRTTPAENGVNHTASLA
FT                   PKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEM
FT                   KDLVKRHHKKTTELIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSA
FT                   IEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEE
FT                   CQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVV
FT                   QYIKRLEEAQSKRQEKLVEKHNEIRQQILDEKPKLQTELEQEYQDKFKRLP"
FT   variation       478
FT                   /gene="Plcb1"
FT                   /replace="a"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       1315
FT                   /gene="Plcb1"
FT                   /replace="c"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       1330
FT                   /gene="Plcb1"
FT                   /replace="c"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       1489
FT                   /gene="Plcb1"
FT                   /replace="g"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       1519
FT                   /gene="Plcb1"
FT                   /replace="c"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       1549
FT                   /gene="Plcb1"
FT                   /replace="a"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       1585
FT                   /gene="Plcb1"
FT                   /replace="t"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       1687
FT                   /gene="Plcb1"
FT                   /replace="a"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       2428
FT                   /gene="Plcb1"
FT                   /replace="g"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       2473
FT                   /gene="Plcb1"
FT                   /replace="c"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       2491
FT                   /gene="Plcb1"
FT                   /replace="t"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       2506
FT                   /gene="Plcb1"
FT                   /replace="g"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       2722
FT                   /gene="Plcb1"
FT                   /replace="g"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       2926
FT                   /gene="Plcb1"
FT                   /replace="g"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       3271
FT                   /gene="Plcb1"
FT                   /replace="g"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       3361
FT                   /gene="Plcb1"
FT                   /replace="c"
FT                   /note="compared to C57BL/6J genome sequence"
FT   variation       3400
FT                   /gene="Plcb1"
FT                   /replace="a"
FT                   /note="compared to C57BL/6J genome sequence"
XX
SQ   Sequence 3573 BP; 1101 A; 826 C; 896 G; 750 T; 0 other;
     agagcctggt gaatcgagag ccaagcccgc tcgcgcccgg agctccgcgt cccgtctcca        60
     ctgcgctcgc ccgggccgcc cggagccccg atgagcccag atggctgggg ctcagcccgg       120
     agtgcacgcc ttgcaactca agcccgtgtg cgtgtccgac agcctcaaga agggcaccaa       180
     attcgtcaag tgggatgatg actccactat tgttactcca attattttga ggactgatcc       240
     tcagggattt ttcttttact ggacagacca gaataaggag acggagctgt tagatctcag       300
     ccttgtcaag gatgccaggt gtgggaagca cgccaaagct cccaaggacc ccaagttgcg       360
     tgaacttctg gatgttggga acatcggaca cttggaacag cgcatgataa ctgtggtgta       420
     tggaccagac ctggtgaaca tttcccactt gaatcttgtg gcttttcaag aggaagtggc       480
     caaggaatgg acaaatgagg ttttcagctt ggcaacaaac ctgctggctc agaacatgtc       540
     cagggacgca tttctggaga aagcatatac taagctcaag ctccaggtca ccccagaagg       600
     ccgcattcct cttaaaaaca tctatcgatt gttctcagca gaccggaagc gcgttgaaac       660
     tgcactagag gcttgtagtc ttccatcttc gaggaatgac tccattcccc aagaggactt       720
     cactccagat gtatacagag ttttcctgaa caatctctgt ccccgacctg aaattgataa       780
     catcttttct gaatttggtg ccaaaagcaa accgtacctg acggttgatc agatgatgga       840
     ttttatcaac cttaagcaga gagatccccg gctcaatgaa atcctttacc cacctctgaa       900
     gcaggagcag gtccaagtgt tgattgagaa atatgagccc aacagcagcc tcgccaagaa       960
     agggcagatg tcagtggatg gattcatgcg ctacctgagc ggagaagaaa atggagtcgt      1020
     ttcacctgag aaactggatt tgaacgaaga catgtctcag cccctgtctc actatttcat      1080
     caattcctcg cacaacacct acctcacagc tggccagttg gctgggaact cgtctgtaga      1140
     gatgtatcgc caggtgcttc tgtctggatg tcgctgtgtg gagctggact gctggaaggg      1200
     aaggaccgct gaggaagagc ctgtcattac ccatggattc accatgacaa cagaaatatc      1260
     cttcaaggaa gtcatagaag ccatcgcaga gtgtgcgttc aagacgtctc cttttcccat      1320
     cctcctttct tttgagaacc acgtggattc cccgaagcaa caagccaaga tggccgagta      1380
     ttgccgatta atctttggtg atgccctcct gatggaacca ctggaaaaat acccactgga      1440
     atctggggta cctcttccaa gccctatgga tttaatgtat aaaatcttag tgaaaaacaa      1500
     gaagaagtcg cacaagtcat cagagggaag tggtaagaag aagctttctg agcaagcttc      1560
     caacacctac agcgactcct ccagcgtgtt cgagccttcg tctccaggag ctggggaagc      1620
     agatacggag agtgatgacg atgacgacga cgatgactgt aaaaagtctt ccatggatga      1680
     ggggactgct ggcagcgaag ccatggccac agaagagatg tctaacctgg tgaactatat      1740
     tcagcctgtc aagtttgagt cctttgaaat ttcaaaaaaa agaaataaaa gctttgaaat      1800
     gtcttccttc gtggaaacca aaggacttga acaacttaca aagtctccgg tggaatttgt      1860
     agaatacaac aagatgcaac ttagcaggat atatcccaag ggaacacgtg tggattcatc      1920
     caactacatg cctcaactct tctggaatgc tggctgtcag atggtggcgc tcaacttcca      1980
     gacagtggat ctagctatgc agataaacat gggcatgtat gagtacaatg ggaagagcgg      2040
     ctataggctg aagccagagt tcatgaggag gccggacaag cattttgatc catttactga      2100
     aggaatcgta gatgggatag tggccaacac tctatctgtt aagattattt caggtcagtt      2160
     cctctctgat aagaaagttg ggacttatgt ggaagtggat atgtttggct tgcctgtgga      2220
     cacaaggagg aaggcattta aaaccaagac atcccaagga aatgctgtaa accctgtctg      2280
     ggaagaagaa cctattgtat tcaaaaaggt agttctacct tctctggcct gtttgaggat      2340
     agcagcatat gaagagggag gcaaatttat tggccaccgg atattgcctg tgcaggctat      2400
     tcggccaggc tatcactaca tctgcctacg gaatgagagg aaccagcccc tgacgctgcc      2460
     agctgtcttt gtttacatag aagtcaaaga ctatgtgcca gacacttatg cagatgtaat      2520
     cgaagctcta tcaaacccaa tccgatatgt caatctgatg gaacagagag ctaagcagct      2580
     ggctgcgttg accctggagg atgaagagga agtaaagaag gaggctgacc ctggagaaac      2640
     atcttccgag gctccaagcg aaaccaggac aacgccagca gagaatgggg tgaatcacac      2700
     cgcatccctt gcacccaagc caccttccca ggctccacac agccagcctg ctccagggtc      2760
     tgtgaaggca cctgccaaaa cagaagatct gatccagagc gtgttaacag aagtagaggc      2820
     gcaaaccatc gaagagctca agcaacagaa atcgttcgtg aaacttcaaa agaaacacta      2880
     caaagaaatg aaagacctgg tgaagagaca ccacaagaaa accacagagc tcattaagga      2940
     gcacacgacc aagtacaacg agattcagaa tgactacctg agaaggaggg cagccttgga      3000
     gaagtccgcc aaaaaggaca gcaagaagaa atctgaaccc agcagccctg accacggctc      3060
     atcagccatt gagcaagacc tcgctgccct ggatgcagaa atgactcaga agttgataga      3120
     cttgaaagac aagcaacaac agcagctgct taatcttcgg caagagcagt attacagcga      3180
     gaagtaccaa aagcgagaac acattaaact gcttattcag aagttgacag atgttgcaga      3240
     agagtgtcag aacaatcagt taaagaagct aaaggaaatc tgcgagaaag agaagaagga      3300
     attaaagaag aaaatggata agaagaggca agagaagata acagaagcca agtccaaaga      3360
     taaaagccag atggaagagg agaagacaga gatgatccgt tcgtacatcc aggaggtggt      3420
     tcagtacatc aagaggttag aggaagcaca aagtaaaaga caagaaaaac tcgtggagaa      3480
     acacaatgag atccgccagc agatcctcga tgagaagccc aagctgcaga cggagctgga      3540
     gcaagaatac caagacaagt tcaaaaggct gcc                                   3573
//


spacer
spacer