Dbfetch

ID   AY792512; SV 1; linear; mRNA; STD; MUS; 7584 BP.
XX
AC   AY792512;
XX
DT   16-NOV-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus leucine-rich repeat kinase 2 (Lrrk2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7584
RA   Zimprich A., Biskup S., Leitner P., Lichtner P., Farrer M., Lincoln S.,
RA   Kachergus J., Hulihan M., Uitti R.J., Calne D.B., Stoessl J.,
RA   Pfeiffer R.F., Patenge N., Carballo I., Vieregge P., Asmus F.,
RA   Mueller-Myhsok B., Meitinger T., Strom T.M., Wszolek Z., Gasser T.;
RT   "Mutations in a large multifunctional protein (LRRK2) cause autosomal
RT   dominant parkinsonism with pleiomorphic a-synuclein and tau-pathology
RT   (PARK8)";
RL   Neuron 0:0-0(2004).
XX
RN   [2]
RP   1-7584
RA   Biskup S., Zimprich A., Strom T.M.;
RT   ;
RL   Submitted (22-OCT-2004) to the INSDC.
RL   Institute of Human Genetics, Technical University and GSF Research Center,
RL   Ingolstaedter Landstr. 1, Muenchen/Neuherberg 85764, Germany
XX
DR   MD5; 2bb86d6364d62eae833b7f431fd2229e.
DR   Ensembl-Gn; ENSMUSG00000036273; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060642; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7584
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /strain="Swiss Webster"
FT                   /mol_type="mRNA"
FT                   /dev_stage="whole embryo E17"
FT                   /db_xref="taxon:10090"
FT   gene            1..7584
FT                   /gene="Lrrk2"
FT   CDS             1..7584
FT                   /codon_start=1
FT                   /gene="Lrrk2"
FT                   /product="leucine-rich repeat kinase 2"
FT                   /db_xref="GOA:Q5S006"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020859"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032171"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1913975"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5S006"
FT                   /protein_id="AAV63976.1"
FT                   /translation="MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDML
FT                   VFTYSDRASKLFEDKNFHVPLLIVLDSYMRVASVQQAGWSLLCKLIEVCPGTLQSLIGP
FT                   QDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKALDLLLDSGKLTLLILDEECDIFL
FT                   LIFDAMHRYSANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYTILLSTFGSFRRDKE
FT                   IVYHVLCCLHSLAVTCSNVEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLTL
FT                   GNFFNILVLNEVHVFVVKAVRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQ
FT                   SEEEDSEKLFWLEPCYKALVRHRKDKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPA
FT                   HREVMLSMLMHSSSKDVFQAAAHALSTLLEQNVNFRKILLAKGVYLNVLELMQKHAHAP
FT                   EVAESGCKMLSHLFEGSNPSLDTMAAVVPKILTVMKAHGTSLSVQLEALRAILHFVVPG
FT                   LLEESREDSQCRPNVLRKQCFRTDIHKLVLVALNRFIGNPGIQKCGLKVISSLAHLPDA
FT                   TETLSLQGAVDSVLHTLQMYPDDQEIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTL
FT                   QRFKDVAEVQTTGLQTTLSILELSVSFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNL
FT                   CCKCFAKVAVDDELKNTMLERACDQNNSIMVECLLLLGADANQVKGATSLIYQVCEKES
FT                   SPKLVELLLNGGCREQDVRKALTISIQKGDSQVISLLLRKLALDLANNSICLGGFGIGK
FT                   IDPSWLGPLFPDKSSNLRKQTNTGSVLARKVLRYQMRNTLQEGVASGSDGNFSEDALAK
FT                   FGEWTFIPDSSMDSVFGQSDDLDSEGSESSFLVKRKSNSISVGEVYRDLALQRYSPNAQ
FT                   RHSNSLGPVFDHEDLLRRKRKILSSDESLRSSRLPSHMRQSDSSSSLASEREHITSLDL
FT                   SANELKDIDALSQKCCLSSHLEHLTKLELHQNSLTSFPQQLCETLKCLIHLDLHSNKFT
FT                   SFPSFVLKMPRITNLDASRNDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVE
FT                   KLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFLA
FT                   AMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSLDMSHNNIECLPGPAHWKSLNLREL
FT                   IFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSF
FT                   PNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNT
FT                   GSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFY
FT                   STHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQ
FT                   RKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVG
FT                   QLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNES
FT                   GVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKHPKGIISRRDVEKFLSKK
FT                   KRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEM
FT                   PYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLD
FT                   NRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYS
FT                   FNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLILADLPRNIMLNNDE
FT                   LEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLI
FT                   SLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIY
FT                   RDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYN
FT                   QQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDELAIQGKLPDPVKEYGCAPWPMVEKL
FT                   ITKCLKENPQERPTSAQVFDILNSAELICLMRHILIPKNIIVECMVATNLNSKSATLWL
FT                   GCGNTEKGQLSLFDLNTERYSYEEVADSRILCLALVHLAAEKESWVVCGTQSGALLVIN
FT                   VEEETKRHTLEKMTDSVTCLHCNSLAKQSKQSNFLLVGTADGNLMIFEDKAVKCKGAAP
FT                   LKTLHIGDVSTPLMCLSESLNSSERHITWGGCGTKVFSFSNDFTIQKLIETKTNQLFSY
FT                   AAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKLNKESK
FT                   HQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATAQLG
FT                   SLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKMRK
FT                   TSVE"
FT   variation       1102..1107
FT                   /gene="Lrrk2"
FT                   /replace=""
FT   misc_difference 3786^3787
FT                   /gene="Lrrk2"
FT                   /replace="c"
FT                   /note="compared to mouse assembly mm5"
FT   variation       7509
FT                   /gene="Lrrk2"
FT                   /replace="g"
XX
SQ   Sequence 7584 BP; 2125 A; 1682 C; 1846 G; 1931 T; 0 other;
     atggccagtg gcgcctgtca gggctgcgaa gaggaagagg aggaggaggc tctgaagaag        60
     ttgatagtca ggctgaataa tgtccaggaa ggcaagcaga tcgagacgtt gcttcagctc       120
     ctggaggaca tgctggtgtt cacctactcg gaccgcgcct ccaagttatt tgaagataaa       180
     aatttccacg tgcctctgtt gattgtcctg gactcctaca tgagagttgc cagtgtacag       240
     caggcggggt ggtcacttct gtgcaaatta atagaagtct gtccagggac attgcaaagc       300
     ttaataggac cccaggatat tggaaatgat tgggaagtcc ttggtattca ccggctgatt       360
     cttaaaatgt taactgttca tcacgccaat gtaaacctgt caatagttgg actaaaagcc       420
     ttggatctcc tcctagattc aggtaaactc accttgctga tactggatga agaatgtgat       480
     attttcttgt taatttttga tgccatgcac agatattcag ccaatgatga agtccaaaaa       540
     ctgggatgca aagctttaca cgtgcttttt gagagagttt ccgaggaaca gctgactgag       600
     tttgtggaga acaaagatta cacgatactg ctgagtacgt tcggcagctt cagaagggac       660
     aaggagattg tgtaccacgt actttgctgc ttgcattccc tggcggttac atgcagcaat       720
     gtagaggtcc tcatgagtgg gaatgtccgg tgctacaatc ttgtggtgga ggccatgaaa       780
     gccttcccca ccaatgaaaa catccaagag gtgagctgct ccttgttcca gaagcttaca       840
     ttaggtaact ttttcaacat cctggtgttg aacgaagtgc atgtctttgt ggtgaaagcg       900
     gtccgacagt atcctgagaa cgcagcctta cagatctctg cactcagctg tttagcactc       960
     ctcactgaga ctattttctt aaaccaagac ttggaggaaa gaagtgagac tcaagagcag      1020
     agcgaagagg aagacagtga gaagcttttc tggctggaac cctgctataa agccctggtg      1080
     cgccatcgaa aggacaaaca cgtgcaggag gctgcctgct gggcactaaa taacctcctt      1140
     atgtaccaga acagtttgca tgagaagatc ggagatgaag atggccagtt ccctgcgcac      1200
     agggaagtga tgctgtctat gctgatgcac tcttcttcca aagatgtctt ccaagcagct      1260
     gcacatgctc tgtccactct cttggaacaa aatgttaatt tcaggaaaat cctgctggca      1320
     aaaggagtat acctgaatgt cttggaattg atgcagaagc atgcccatgc gcctgaggtg      1380
     gcagagagtg gctgcaagat gctgagtcac ctgtttgaag gaagtaaccc ttctctggat      1440
     acaatggcag cagtggtccc taaaatacta acagtgatga aagcccacgg aacgtctctg      1500
     tcagtccagc tggaggcgct gcgagctatc ttgcatttcg ttgtgccagg actattggaa      1560
     gaatccaggg aggactctca atgcagacca aatgtgctca gaaaacagtg tttcaggact      1620
     gacatccaca agctggttct agtcgctctg aacaggttca ttgggaatcc tgggattcag      1680
     aaatgtggat tgaaagtaat ctcttctctc gcgcaccttc ctgatgccac agagacattg      1740
     tccctgcaag gagcagttga ctcagtcctc cacaccttac agatgtatcc agatgaccaa      1800
     gaaattcagt gtctgggctt acaccttatg ggatgcttga tgacaaagaa gaatttctgc      1860
     atagggacag ggcacctcct ggcaaaaatt ctggcttcca ctttgcagcg ctttaaagat      1920
     gttgctgagg tgcagactac aggattacag acaaccctgt caatacttga gctgtcagta      1980
     tctttctcca agctgctagt gcactattcc tttgatgtgg tgatatttca tcagatgtct      2040
     tccagtgttg tagaacaaaa ggatgagcag ttcctcaatc tatgttgcaa atgctttgca      2100
     aaagtggccg tggatgatga gctgaaaaac accatgctag agagagcctg cgatcagaat      2160
     aacagcatca tggttgaatg tttgctcctc ttgggagctg atgccaacca agtgaagggg      2220
     gcaacttctt taatctatca ggtatgtgag aaagagagca gtcctaaatt ggtggaactg      2280
     ttgcttaatg gtggttgtcg tgaacaagat gtacggaaag ccctgaccat aagcatccaa      2340
     aagggcgaca gccaggtcat cagcttgctc ctcaggaaac ttgccctgga cctggccaac      2400
     aacagcattt gccttggagg atttggcata ggaaaaattg atccttcttg gcttggtcct      2460
     ttatttccag ataagtcatc caatttaagg aagcaaacaa acacaggatc tgtcctagcg      2520
     aggaaagtgc tccggtatca gatgagaaac acccttcaag aaggcgtggc ctcaggcagt      2580
     gacggcaact tctctgaaga cgcgctggcg aaatttggag aatggacctt tattcccgac      2640
     tcttctatgg acagtgtgtt tggccagagc gatgatctgg atagcgaagg cagcgagagc      2700
     tcatttctcg tgaagaggaa gtccaactca attagtgtag gggaagttta cagagatcta      2760
     gctctgcagc gctactcacc aaatgctcag aggcattcca attcgctggg tcctgttttt      2820
     gaccatgaag acttactgag acgaaaaaga aaaatactgt cttcagatga gtctctcagg      2880
     tcctcaaggc tgccgtccca tatgaggcaa tcagatagct cttcttccct ggcttctgag      2940
     agagaacaca tcacgtcgtt agacctatct gccaacgaac tcaaagatat tgatgctctg      3000
     agccagaagt gttgcctcag tagccacctg gaacatctca ccaaactgga acttcaccag      3060
     aattcactca cgagcttccc acagcagctg tgtgagactc tgaagtgttt gatacacttg      3120
     gatttgcaca gtaacaaatt cacctcattt ccctctttcg tgttgaaaat gccacgtatc      3180
     accaacctag atgcctctcg aaatgacatc gggccaacag tagttttaga ccctgcgatg      3240
     aagtgtccaa gcctcaaaca gttgaatctg tcctataacc agctctcttc aatcccagag      3300
     aatcttgccc aagtggtgga gaaacttgag cagctcctac tggaaggaaa taaaatatcc      3360
     gggatttgct ctcccctgag cctgaaggaa ctgaagattt taaatcttag taaaaatcac      3420
     attccatccc tacctggaga ttttcttgag gcttgttcaa aagtcgagag tttcagtgct      3480
     cgcatgaatt ttcttgctgc aatgcctgcc ttaccttctt ccataacgag cttaaaattg      3540
     tctcagaact ctttcacgtg cattccagaa gcgattttca gtcttccgca cttgcggtcc      3600
     ttggatatga gccacaacaa cattgaatgt ctgccgggac ctgcacattg gaagtctctg      3660
     aacttaaggg aactcatttt tagcaagaat cagatcagca ccttagactt tagtgagaac      3720
     ccacacgtgt ggtcaagagt agagaaactg catctctctc ataataaact gaaagagatt      3780
     cctccagaaa ttggctgcct tgaaaatctg acgtctctcg acgtcagtta caacttggaa      3840
     ctgaggtcct tcccaaatga aatggggaag ttgagcaaga tatgggatct tcccttggac      3900
     ggactgcatc tgaattttga ctttaagcac gtaggatgca aggccaaaga catcataagg      3960
     tttctacaac aacgtctgaa aaaggctgta ccctacaacc gaatgaagct catgattgtg      4020
     ggaaatacgg ggagcggtaa gaccacttta ctgcaacaac tcatgaaaat gaagaaacca      4080
     gaacttggca tgcagggtgc cacagtcggc atagacgtgc gagactggtc catccaaata      4140
     cggggcaaaa ggagaaagga cctggttcta aacgtgtggg attttgcagg tcgtgaggaa      4200
     ttctacagca ctcaccccca cttcatgacc cagagagccc tctacctggc tgtctatgat      4260
     ctcagcaagg ggcaggcaga ggtggacgcc atgaagccct ggctcttcaa tatcaaggct      4320
     cgtgcctctt cttccccggt gattctggtg ggcacacatt tggatgtttc tgatgagaag      4380
     cagcggaaag cgtgcataag caaaatcacg aaggaactcc taaataagcg aggattcccc      4440
     accatccggg actaccactt tgtgaatgcc accgaggagt cagatgcgct ggcaaagctt      4500
     cggaaaacca tcataaatga gagccttaat ttcaagatcc gagatcagcc tgtggttggg      4560
     cagctaattc cagattgcta tgtagaactg gagaaaatca ttttatcaga gcggaaagct      4620
     gtgccgactg agtttcctgt gattaaccgg aaacacctgt tacagctcgt gaacgaacat      4680
     cagctgcagc tggatgagaa cgagctccca cacgccgttc acttcctaaa tgagtcggga      4740
     gttcttctgc attttcaaga ccctgccctg cagctaagtg acctgtactt tgtggaaccc      4800
     aagtggcttt gtaaagtcat ggcacagatc ttgacagtga aggtggacgg ctgtctgaaa      4860
     catcccaagg gcatcatttc ccggagagat gtggaaaagt tcctttcaaa gaaaaagcga      4920
     ttcccaaaga actacatgat gcaatacttt aaactattag aaaaatttca gatcgcattg      4980
     ccaatagggg aagaatatct tctggttcca agcagcttgt ctgaccacag gccagtgata      5040
     gagctccccc actgtgagaa ctctgagatc atcatccggc tgtacgaaat gccgtacttt      5100
     cccatgggat tttggtcaag attgattaac cgattacttg aaatctcacc cttcatgctt      5160
     tctggcagag agagagcact acgccctaac aggatgtatt ggcggcaagg catctacttg      5220
     aattggtctc cagaagcata ctgtctggta ggctctgaag tcttagacaa tcgacctgag      5280
     agtttcttga aaatcacggt tccgtcttgt agaaaaggtt gtattcttct gggccgagtt      5340
     gtggatcata ttgactcact catggaagaa tggtttcccg ggttactgga gattgacatt      5400
     tgtggggaag gagaaactct gttgaagaaa tgggcattgt acagttttaa tgatggtgaa      5460
     gaacatcaga agatcttgct tgatgagttg atgaagaagg ctgaagaagg agacctgtta      5520
     ataaatccag accaaccaag gctcactatt ccaatatccc agattgctcc ggacttgatc      5580
     ttggctgacc tgcctagaaa tatcatgttg aacaatgatg agttggaatt tgaggaagca      5640
     ccagagtttc tcttaggcga tggaagtttt ggatccgttt atcgagctgc ctacgaagga      5700
     gaggaagtgg ctgtgaagat ttttaataag cacacatctc ttaggctgtt aagacaagag      5760
     ttggtggtcc tttgtcacct tcaccacccc agcctgatat ccttgctggc ggctggtatt      5820
     cgtcctcgga tgttggtaat ggagttggcc tccaaaggtt ccttggatcg cctgctgcag      5880
     caggacaaag ccagcctcac cagaaccctc cagcacagga tcgcgttgca tgtggccgac      5940
     ggcctgaggt atctccactc agccatgatt atttaccgtg acctgaagcc ccacaatgtg      6000
     ctgcttttta ccctgtatcc caatgctgcc atcattgcga agattgcgga ctacgggatc      6060
     gcacagtact gctgcaggat gggaataaag acatcagagg gcaccccagg gttccgggca      6120
     cctgaagttg ccagggggaa tgtcatttat aaccaacagg ccgatgttta ttcttttggc      6180
     ttactacttc acgatatttg gacaactggg agtaggatta tggagggttt gaggttccca      6240
     aatgagtttg atgagttagc catacaaggg aagttgccag atccagttaa agaatatggc      6300
     tgtgccccat ggcctatggt tgagaagtta attacaaagt gtttgaaaga aaatcctcaa      6360
     gaaagaccca cttctgccca ggtctttgac attttgaatt cggctgaatt aatttgcctc      6420
     atgcgacaca ttttaatacc taagaacatc attgttgaat gcatggttgc cacgaatctc      6480
     aatagcaaga gtgcgactct ctggttggga tgtgggaaca cagaaaaagg acagctttcc      6540
     ttatttgact taaacacgga aagatacagc tatgaggaag ttgctgatag tagaatactg      6600
     tgcttggctt tggtgcatct cgctgctgag aaagagagct gggttgtgtg cgggacacag      6660
     tctggggctc tcctggtcat caatgttgaa gaggagacaa agagacacac cctggaaaag      6720
     atgactgatt ctgtcacttg tttgcattgc aattcccttg ccaagcagag caagcaaagt      6780
     aactttcttt tggtgggaac tgctgatggt aacttaatga tatttgaaga taaagccgtt      6840
     aagtgtaaag gagctgcccc cttgaagaca ctacacatag gcgatgtcag tacgcccctg      6900
     atgtgcctga gcgagtccct gaattcatct gaaagacaca tcacatgggg agggtgtggc      6960
     acaaaggtct tctccttttc caatgatttc accattcaga aactcatcga gacaaaaacc      7020
     aaccagctgt tttcttacgc agctttcagc gattctaaca tcatagcgct ggcagtagac      7080
     acagccctgt atattgccaa gaaaaacagc cctgtcgtag aggtgtggga caagaaaaca      7140
     gaaaagctct gtgaattaat agactgtgtg cacttcttaa aggaggtgat ggtaaaacta      7200
     aacaaggaat cgaaacatca gctgtcctac tctgggaggg tgaaggccct ctgcctgcag      7260
     aagaacacgg ctctctggat cggaactgga ggaggccaca tcttactcct ggatctttct      7320
     actcggcgag ttatccgcac cattcacaat ttctgtgatt ctgtgagagc catggccaca      7380
     gcacaattag gaagccttaa gaatgtcatg ctggttttgg ggtacaagcg gaagagtaca      7440
     gagggtatcc aagaacaaaa agagatacaa tcttgtttgt ctatttggga cctcaatctt      7500
     ccacacgaag tgcaaaattt agaaaaacac attgaagtaa gaacagaatt agctgataaa      7560
     atgaggaaaa catctgttga atag                                             7584
//