Dbfetch

ID   AY792511; SV 1; linear; mRNA; STD; HUM; 7584 BP.
XX
AC   AY792511;
XX
DT   16-NOV-2004 (Rel. 81, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens leucine-rich repeat kinase 2 (LRRK2) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7584
RA   Zimprich A., Biskup S., Leitner P., Lichtner P., Farrer M., Lincoln S.,
RA   Kachergus J., Hulihan M., Uitti R.J., Calne D.B., Stoessl J.,
RA   Pfeiffer R.F., Patenge N., Carballo I., Vieregge P., Asmus F.,
RA   Mueller-Myhsok B., Meitinger T., Strom T.M., Wszolek Z., Gasser T.;
RT   "Mutations in a large multifunctional protein (LRRK2) cause autosomal
RT   dominant parkinsonism with pleiomorphic a-synuclein and tau-pathology
RT   (PARK8)";
RL   Neuron 0:0-0(2004).
XX
RN   [2]
RP   1-7584
RA   Zimprich A., Biskup S., Strom T.M.;
RT   ;
RL   Submitted (22-OCT-2004) to the INSDC.
RL   Institute of Human Genetics, Technical University and GSF Research Center,
RL   Ingolstaedter Landstr. 1, Muenchen/Neuherberg 85764, Germany
XX
DR   MD5; 39775dd1384b045fb7eb00343e52728b.
DR   Ensembl-Gn; ENSG00000188906; homo_sapiens.
DR   Ensembl-Tr; ENST00000298910; homo_sapiens.
DR   EuropePMC; PMC1199304; 15726496.
DR   EuropePMC; PMC1224537; 16145815.
DR   EuropePMC; PMC1317945; 16352719.
DR   EuropePMC; PMC1735940; 16272257.
DR   EuropePMC; PMC2083285; 17706965.
DR   EuropePMC; PMC2586915; 18214993.
DR   EuropePMC; PMC2851569; 20386743.
DR   EuropePMC; PMC2970614; 20669305.
DR   EuropePMC; PMC4126812; 24915984.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7584
FT                   /organism="Homo sapiens"
FT                   /chromosome="12"
FT                   /map="12q12"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   gene            1..7584
FT                   /gene="LRRK2"
FT   CDS             1..7584
FT                   /codon_start=1
FT                   /gene="LRRK2"
FT                   /product="leucine-rich repeat kinase 2"
FT                   /db_xref="GOA:Q5S007"
FT                   /db_xref="H-InvDB:HIT000257811.14"
FT                   /db_xref="HGNC:HGNC:18618"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR020859"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032171"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="PDB:2ZEJ"
FT                   /db_xref="PDB:3D6T"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5S007"
FT                   /protein_id="AAV63975.1"
FT                   /translation="MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVF
FT                   TYSEHASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQD
FT                   VGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLI
FT                   FDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSASTNFKDEEEIV
FT                   LHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGN
FT                   FFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDD
FT                   EGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHR
FT                   EVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEV
FT                   AESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMP
FT                   EESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDA
FT                   LEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSL
FT                   YRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNL
FT                   CCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKES
FT                   SPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGK
FT                   VEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSK
FT                   FDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQ
FT                   RHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDL
FT                   SANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFT
FT                   SFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVE
FT                   KLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLA
FT                   AMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLREL
FT                   LFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSF
FT                   PNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNT
FT                   GSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFY
FT                   STHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQ
FT                   RKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVG
FT                   QLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNES
FT                   GVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKK
FT                   RKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEM
FT                   PYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLD
FT                   NHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYS
FT                   FNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDE
FT                   LEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLI
FT                   SLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIY
FT                   RDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYN
FT                   QQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKL
FT                   IKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWL
FT                   GCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVIN
FT                   TEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAP
FT                   LKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSY
FT                   AAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESK
FT                   HKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLG
FT                   SLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRR
FT                   TSVE"
FT   misc_difference 149
FT                   /gene="LRRK2"
FT                   /replace="g"
FT                   /note="compared to genome assembly"
FT   variation       3364
FT                   /phenotype="PARK8"
FT                   /gene="LRRK2"
FT                   /replace="g"
FT                   /note="I1122V"
FT   variation       4321
FT                   /phenotype="PARK8"
FT                   /gene="LRRK2"
FT                   /replace="t"
FT                   /note="R1441C"
FT   variation       5096
FT                   /phenotype="PARK8"
FT                   /gene="LRRK2"
FT                   /replace="g"
FT                   /note="Y1699C"
FT   variation       5457
FT                   /gene="LRRK2"
FT                   /replace="t"
FT                   /note="nonsynonymous SNP"
XX
SQ   Sequence 7584 BP; 2359 A; 1400 C; 1653 G; 2172 T; 0 other;
     atggctagtg gcagctgtca ggggtgcgaa gaggacgagg aaactctgaa gaagttgata        60
     gtcaggctga acaatgtcca ggaaggaaaa cagatagaaa cgctggtcca aatcctggag       120
     gatctgctgg tgttcacgta ctccgagcac gcctccaagt tatttcaagg caaaaatatc       180
     catgtgcctc tgttgatcgt cttggactcc tatatgagag tcgcgagtgt gcagcaggtg       240
     ggttggtcac ttctgtgcaa attaatagaa gtctgtccag gtacaatgca aagcttaatg       300
     ggaccccagg atgttggaaa tgattgggaa gtccttggtg ttcaccaatt gattcttaaa       360
     atgctaacag ttcataatgc cagtgtaaac ttgtcagtga ttggactgaa gaccttagat       420
     ctcctcctaa cttcaggtaa aatcaccttg ctgatactgg atgaagaaag tgatattttc       480
     atgttaattt ttgatgccat gcactcattt ccagccaatg atgaagtcca gaaacttgga       540
     tgcaaagctt tacatgtgct gtttgagaga gtctcagagg agcaactgac tgaatttgtt       600
     gagaacaaag attatatgat attgttaagt gcgtcaacaa attttaaaga tgaagaggaa       660
     attgtgcttc atgtgctgca ttgtttacat tccctagcga ttccttgcaa taatgtggaa       720
     gtcctcatga gtggcaatgt caggtgttat aatattgtgg tggaagctat gaaagcattc       780
     cctatgagtg aaagaattca agaagtgagt tgctgtttgc tccataggct tacattaggt       840
     aattttttca atatcctggt attaaacgaa gtccatgagt ttgtggtgaa agctgtgcag       900
     cagtacccag agaatgcagc attgcagatc tcagcgctca gctgtttggc cctcctcact       960
     gagactattt tcttaaatca agatttagag gaaaagaatg agaatcaaga gaatgatgat      1020
     gagggggaag aagataaatt gttttggctg gaagcctgtt acaaagcatt aacgtggcat      1080
     agaaagaaca agcacgtgca ggaggccgca tgctgggcac taaataatct ccttatgtac      1140
     caaaacagtt tacatgagaa gattggagat gaagatggcc atttcccagc tcatagggaa      1200
     gtgatgctct ccatgctgat gcattcttca tcaaaggaag ttttccaggc atctgcgaat      1260
     gcattgtcaa ctctcttaga acaaaatgtt aatttcagaa aaatactgtt atcaaaagga      1320
     atacacctga atgttttgga gttaatgcag aagcatatac attctcctga agtggctgaa      1380
     agtggctgta aaatgctaaa tcatcttttt gaaggaagca acacttccct ggatataatg      1440
     gcagcagtgg tccccaaaat actaacagtt atgaaacgtc atgagacatc attaccagtg      1500
     cagctggagg cgcttcgagc tattttacat tttatagtgc ctggcatgcc agaagaatcc      1560
     agggaggata cagaatttca tcataagcta aatatggtta aaaaacagtg tttcaagaat      1620
     gatattcaca aactggtcct agcagctttg aacaggttca ttggaaatcc tgggattcag      1680
     aaatgtggat taaaagtaat ttcttctatt gtacattttc ctgatgcatt agagatgtta      1740
     tccctggaag gtgctatgga ttcagtgctt cacacactgc agatgtatcc agatgaccaa      1800
     gaaattcagt gtctgggttt aagtcttata ggatacttga ttacaaagaa gaatgtgttc      1860
     ataggaactg gacatctgct ggcaaaaatt ctggtttcca gcttataccg atttaaggat      1920
     gttgctgaaa tacagactaa aggatttcag acaatcttag caatcctcaa attgtcagca      1980
     tctttttcta agctgctggt gcatcattca tttgacttag taatattcca tcaaatgtct      2040
     tccaatatca tggaacaaaa ggatcaacag tttctaaacc tctgttgcaa gtgttttgca      2100
     aaagtagcta tggatgatta cttaaaaaat gtgatgctag agagagcgtg tgatcagaat      2160
     aacagcatca tggttgaatg cttgcttcta ttgggagcag atgccaatca agcaaaggag      2220
     ggatcttctt taatttgtca ggtatgtgag aaagagagca gtcccaaatt ggtggaactc      2280
     ttactgaata gtggatctcg tgaacaagat gtacgaaaag cgttgacgat aagcattggg      2340
     aaaggtgaca gccagatcat cagcttgctc ttaaggaggc tggccctgga tgtggccaac      2400
     aatagcattt gccttggagg attttgtata ggaaaagttg aaccttcttg gcttggtcct      2460
     ttatttccag ataagacttc taatttaagg aaacaaacaa atatagcatc tacactagca      2520
     agaatggtga tcagatatca gatgaaaagt gctgtggaag aaggaacagc ctcaggcagc      2580
     gatggaaatt tttctgaaga tgtgctgtct aaatttgatg aatggacctt tattcctgac      2640
     tcttctatgg acagtgtgtt tgctcaaagt gatgacctgg atagtgaagg aagtgaaggc      2700
     tcatttcttg tgaaaaagaa atctaattca attagtgtag gagaatttta ccgagatgcc      2760
     gtattacagc gttgctcacc aaatttgcaa agacattcca attccttggg gcccattttt      2820
     gatcatgaag atttactgaa gcgaaaaaga aaaatactat cttcagatga ttcactcagg      2880
     tcatcaaaac ttcaatccca tatgaggcat tcagacagca tttcttctct ggcttctgag      2940
     agagaatata ttacatcact agacctttca gcaaatgaac taagagatat tgatgcccta      3000
     agccagaaat gctgtataag tgttcatttg gagcatcttg aaaagctgga gcttcaccag      3060
     aatgcactca cgagctttcc acaacagcta tgtgaaactc tgaagagttt gacacatttg      3120
     gacttgcaca gtaataaatt tacatcattt ccttcttatt tgttgaaaat gagttgtatt      3180
     gctaatcttg atgtctctcg aaatgacatt ggaccctcag tggttttaga tcctacagtg      3240
     aaatgtccaa ctctgaaaca gtttaacctg tcatataacc agctgtcttt tgtacctgag      3300
     aacctcactg atgtggtaga gaaactggag cagctcattt tagaaggaaa taaaatatca      3360
     gggatatgct cccccttgag actgaaggaa ctgaagattt taaaccttag taagaaccac      3420
     atttcatccc tatcagagaa ctttcttgag gcttgtccta aagtggagag tttcagtgcc      3480
     agaatgaatt ttcttgctgc tatgcctttc ttgcctcctt ctatgacaat cctaaaatta      3540
     tctcagaaca aattttcctg tattccagaa gcaattttaa atcttccaca cttgcggtct      3600
     ttagatatga gcagcaatga tattcagtac ctaccaggtc ccgcacactg gaaatctttg      3660
     aacttaaggg aactcttatt tagccataat cagatcagca tcttggactt gagtgaaaaa      3720
     gcatatttat ggtctagagt agagaaactg catctttctc acaataaact gaaagagatt      3780
     cctcctgaga ttggctgtct tgaaaatctg acatctctgg atgtcagtta caacttggaa      3840
     ctaagatcct ttcccaatga aatggggaaa ttaagcaaaa tatgggatct tcctttggat      3900
     gaactgcatc ttaactttga ttttaaacat ataggatgta aagccaaaga catcataagg      3960
     tttcttcaac agcgattaaa aaaggctgtg ccttataacc gaatgaaact tatgattgtg      4020
     ggaaatactg ggagtggtaa aaccacctta ttgcagcaat taatgaaaac caagaaatca      4080
     gatcttggaa tgcaaagtgc cacagttggc atagatgtga aagactggcc tatccaaata      4140
     agagacaaaa gaaagagaga tctcgtccta aatgtgtggg attttgcagg tcgtgaggaa      4200
     ttctatagta ctcatcccca ttttatgacg cagcgagcat tgtaccttgc tgtctatgac      4260
     ctcagcaagg gacaggctga agttgatgcc atgaagcctt ggctcttcaa tataaaggct      4320
     cgcgcttctt cttcccctgt gattctcgtt ggcacacatt tggatgtttc tgatgagaag      4380
     caacgcaaag cctgcatgag taaaatcacc aaggaactcc tgaataagcg agggttccct      4440
     gccatacgag attaccactt tgtgaatgcc accgaggaat ctgatgcttt ggcaaaactt      4500
     cggaaaacca tcataaacga gagccttaat ttcaagatcc gagatcagct tgttgttgga      4560
     cagctgattc cagactgcta tgtagaactt gaaaaaatca ttttatcgga gcgtaaaaat      4620
     gtgccaattg aatttcccgt aattgaccgg aaacgattat tacaactagt gagagaaaat      4680
     cagctgcagt tagatgaaaa tgagcttcct cacgcagttc actttctaaa tgaatcagga      4740
     gtccttcttc attttcaaga cccagcactg cagttaagtg acttgtactt tgtggaaccc      4800
     aagtggcttt gtaaaatcat ggcacagatt ttgacagtga aagtggaagg ttgtccaaaa      4860
     caccctaagg gcattatttc gcgtagagat gtggaaaaat ttctttcaaa aaaaaggaaa      4920
     tttccaaaga actacatgtc acagtatttt aagctcctag aaaaattcca gattgctttg      4980
     ccaataggag aagaatattt gctggttcca agcagtttgt ctgaccacag gcctgtgata      5040
     gagcttcccc attgtgagaa ctctgaaatt atcatccgac tatatgaaat gccttatttt      5100
     ccaatgggat tttggtcaag attaatcaat cgattacttg agatttcacc ttacatgctt      5160
     tcagggagag aacgagcact tcgcccaaac agaatgtatt ggcgacaagg catttactta      5220
     aattggtctc ctgaagctta ttgtctggta ggatctgaag tcttagacaa tcatccagag      5280
     agtttcttaa aaattacagt tccttcttgt agaaaaggct gtattctttt gggccaagtt      5340
     gtggaccaca ttgattctct catggaagaa tggtttcctg ggttgctgga gattgatatt      5400
     tgtggtgaag gagaaactct gttgaagaaa tgggcattat atagttttaa tgatggcgaa      5460
     gaacatcaaa aaatcttact tgatgacttg atgaagaaag cagaggaagg agatctctta      5520
     gtaaatccag atcaaccaag gctcaccatt ccaatatctc agattgcccc tgacttgatt      5580
     ttggctgacc tgcctagaaa tattatgttg aataatgatg agttggaatt tgaacaagct      5640
     ccagagtttc tcctaggtga tggcagtttt ggatcagttt accgagcagc ctatgaagga      5700
     gaagaagtgg ctgtgaagat ttttaataaa catacatcac tcaggctgtt aagacaagag      5760
     cttgtggtgc tttgccacct ccaccacccc agtttgatat ctttgctggc agctgggatt      5820
     cgtccccgga tgttggtgat ggagttagcc tccaagggtt ccttggatcg cctgcttcag      5880
     caggacaaag ccagcctcac tagaacccta cagcacagga ttgcactcca cgtagctgat      5940
     ggtttgagat acctccactc agccatgatt atataccgag acctgaaacc ccacaatgtg      6000
     ctgcttttca cactgtatcc caatgctgcc atcattgcaa agattgctga ctacggcatt      6060
     gctcagtact gctgtagaat ggggataaaa acatcagagg gcacaccagg gtttcgtgca      6120
     cctgaagttg ccagaggaaa tgtcatttat aaccaacagg ctgatgttta ttcatttggt      6180
     ttactactct atgacatttt gacaactgga ggtagaatag tagagggttt gaagtttcca      6240
     aatgagtttg atgaattaga aatacaagga aaattacctg atccagttaa agaatatggt      6300
     tgtgccccat ggcctatggt tgagaaatta attaaacagt gtttgaaaga aaatcctcaa      6360
     gaaaggccta cttctgccca ggtctttgac attttgaatt cagctgaatt agtctgtctg      6420
     acgagacgca ttttattacc taaaaacgta attgttgaat gcatggttgc tacacatcac      6480
     aacagcagga atgcaagcat ttggctgggc tgtgggcaca ccgacagagg acagctctca      6540
     tttcttgact taaatactga aggatacact tctgaggaag ttgctgatag tagaatattg      6600
     tgcttagcct tggtgcatct tcctgttgaa aaggaaagct ggattgtgtc tgggacacag      6660
     tctggtactc tcctggtcat caataccgaa gatgggaaaa agagacatac cctagaaaag      6720
     atgactgatt ctgtcacttg tttgtattgc aattcctttt ccaagcaaag caaacaaaaa      6780
     aattttcttt tggttggaac cgctgatggc aagttagcaa tttttgaaga taagactgtt      6840
     aagcttaaag gagctgctcc tttgaagata ctaaatatag gaaatgtcag tactccattg      6900
     atgtgtttga gtgaatccac aaattcaacg gaaagaaatg taatgtgggg aggatgtggc      6960
     acaaagattt tctccttttc taatgatttc accattcaga aactcattga gacaagaaca      7020
     agccaactgt tttcttatgc agctttcagt gattccaaca tcataacagt ggtggtagac      7080
     actgctctct atattgctaa gcaaaatagc cctgttgtgg aagtgtggga taagaaaact      7140
     gaaaaactct gtggactaat agactgcgtg cactttttaa gggaggtaat ggtaaaagaa      7200
     aacaaggaat caaaacacaa aatgtcttat tctgggagag tgaaaaccct ctgccttcag      7260
     aagaacactg ctctttggat aggaactgga ggaggccata ttttactcct ggatctttca      7320
     actcgtcgac ttatacgtgt aatttacaac ttttgtaatt cggtcagagt catgatgaca      7380
     gcacagctag gaagccttaa aaatgtcatg ctggtattgg gctacaaccg gaaaaatact      7440
     gaaggtacac aaaagcagaa agagatacaa tcttgcttga ccgtttggga catcaatctt      7500
     ccacatgaag tgcaaaattt agaaaaacac attgaagtga gaaaagaatt agctgaaaaa      7560
     atgagacgaa catctgttga gtaa                                             7584
//