spacer

EBI Dbfetch

ID   AY755627; SV 1; linear; mRNA; STD; HUM; 493 BP.
XX
AC   AY755627;
XX
DT   01-OCT-2005 (Rel. 85, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens receptor for advanced glycosylation end-products deletion
DE   exon3-10 variant (AGER) mRNA, complete cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-493
RX   PUBMED; 18089847.
RA   Hudson B.I., Carter A.M., Harja E., Kalea A.Z., Arriero M., Yang H.,
RA   Grant P.J., Schmidt A.M.;
RT   "Identification, classification, and expression of RAGE gene splice
RT   variants";
RL   FASEB J. 22(5):1572-1580(2008).
XX
RN   [2]
RP   1-493
RA   Hudson B.I., Carter A.M., Harja E., Arriero M., Yang H., Moser B.,
RA   Grant P.J., Schmidt A.M.;
RT   "The Rapid Identification, Characterization and Expression of Gene Splice
RT   Variants";
RL   Unpublished.
XX
RN   [3]
RP   1-493
RA   Hudson B.I., Schmidt A.M.;
RT   ;
RL   Submitted (21-SEP-2004) to the INSDC.
RL   Surgery, Columbia University, 630W 168th St, New York, NY 10032, USA
XX
DR   MD5; 66515137fcb86260a72ca4c1b66661ae.
DR   Ensembl-Gn; ENSG00000206320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229058; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234729; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237405; homo_sapiens.
DR   Ensembl-Tr; ENST00000548034; homo_sapiens.
DR   Ensembl-Tr; ENST00000549626; homo_sapiens.
DR   Ensembl-Tr; ENST00000550959; homo_sapiens.
DR   Ensembl-Tr; ENST00000552991; homo_sapiens.
DR   H-InvDB; HIT000332260_04.4.
DR   H-InvDB; HIT000332260_05.4.
DR   H-InvDB; HIT000332260_06.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..493
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:9606"
FT   gene            1..493
FT                   /gene="AGER"
FT   CDS             11..472
FT                   /codon_start=1
FT                   /gene="AGER"
FT                   /product="receptor for advanced glycosylation end-products
FT                   deletion exon3-10 variant"
FT                   /note="RAGEdelex3-10; alternatively spliced"
FT                   /db_xref="H-InvDB:HIT000332260_03.4"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3L1R2"
FT                   /protein_id="AAX07280.1"
FT                   /translation="MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKP
FT                   PQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGILGGLGTAA
FT                   LLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP"
XX
SQ   Sequence 493 BP; 115 A; 126 C; 179 G; 73 T; 0 other;
     aggaagcagg atggcagccg gaacagcagt tggagcctgg gtgctggtcc tcagtctgtg        60
     gggggcagta gtaggtgctc aaaacatcac agcccggatt ggcgagccac tggtgctgaa       120
     gtgtaagggg gcccccaaga aaccacccca gcggctggaa tggaaactga acacaggccg       180
     gacagaagct tggaaggtcc tgtctcccca gggaggaggc ccctgggaca gtgtggctcg       240
     tgtccttccc aacggctccc tcttccttcc ggctgtcggg atccaggatg aggggatcct       300
     gggaggcctg gggacagccg ccctgctcat tggggtcatc ttgtggcaaa ggcggcaacg       360
     ccgaggagag gagaggaagg ccccagaaaa ccaggaggaa gaggaggagc gtgcagaact       420
     gaatcagtcg gaggaacctg aggcaggcga gagtagtact ggagggcctt gaggggccca       480
     cagacagatc cca                                                          493
//


spacer
spacer