Dbfetch

ID   AY755624; SV 1; linear; mRNA; STD; HUM; 1204 BP.
XX
AC   AY755624;
XX
DT   01-OCT-2005 (Rel. 85, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens receptor for advanced glycosylation end-products deletion exon
DE   3 variant (AGER) mRNA, complete cds, alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1204
RX   PUBMED; 18089847.
RA   Hudson B.I., Carter A.M., Harja E., Kalea A.Z., Arriero M., Yang H.,
RA   Grant P.J., Schmidt A.M.;
RT   "Identification, classification, and expression of RAGE gene splice
RT   variants";
RL   FASEB J. 22(5):1572-1580(2008).
XX
RN   [2]
RP   1-1204
RA   Hudson B.I., Carter A.M., Harja E., Arriero M., Yang H., Moser B.,
RA   Grant P.J., Schmidt A.M.;
RT   "The Rapid Identification, Characterization and Expression of Gene Splice
RT   Variants";
RL   Unpublished.
XX
RN   [3]
RP   1-1204
RA   Hudson B.I., Schmidt A.M.;
RT   ;
RL   Submitted (21-SEP-2004) to the INSDC.
RL   Surgery, Columbia University, 630W 168th St, New York, NY 10032, USA
XX
DR   MD5; 4decfd29806e342167d4c6e6f9efa6bc.
DR   Ensembl-Gn; ENSG00000204305; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206320; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229058; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230514; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231268; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234729; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237405; homo_sapiens.
DR   Ensembl-Tr; ENST00000375055; homo_sapiens.
DR   Ensembl-Tr; ENST00000375067; homo_sapiens.
DR   Ensembl-Tr; ENST00000375069; homo_sapiens.
DR   Ensembl-Tr; ENST00000375076; homo_sapiens.
DR   Ensembl-Tr; ENST00000383275; homo_sapiens.
DR   Ensembl-Tr; ENST00000383279; homo_sapiens.
DR   Ensembl-Tr; ENST00000412470; homo_sapiens.
DR   Ensembl-Tr; ENST00000426138; homo_sapiens.
DR   Ensembl-Tr; ENST00000427822; homo_sapiens.
DR   Ensembl-Tr; ENST00000432831; homo_sapiens.
DR   Ensembl-Tr; ENST00000436456; homo_sapiens.
DR   Ensembl-Tr; ENST00000438221; homo_sapiens.
DR   Ensembl-Tr; ENST00000441180; homo_sapiens.
DR   Ensembl-Tr; ENST00000441804; homo_sapiens.
DR   Ensembl-Tr; ENST00000447921; homo_sapiens.
DR   Ensembl-Tr; ENST00000449037; homo_sapiens.
DR   Ensembl-Tr; ENST00000451115; homo_sapiens.
DR   Ensembl-Tr; ENST00000453588; homo_sapiens.
DR   Ensembl-Tr; ENST00000456918; homo_sapiens.
DR   Ensembl-Tr; ENST00000547328; homo_sapiens.
DR   Ensembl-Tr; ENST00000547651; homo_sapiens.
DR   Ensembl-Tr; ENST00000548464; homo_sapiens.
DR   Ensembl-Tr; ENST00000549758; homo_sapiens.
DR   Ensembl-Tr; ENST00000550562; homo_sapiens.
DR   Ensembl-Tr; ENST00000551254; homo_sapiens.
DR   Ensembl-Tr; ENST00000551381; homo_sapiens.
DR   Ensembl-Tr; ENST00000551827; homo_sapiens.
DR   H-InvDB; HIT000332257_04.4.
DR   H-InvDB; HIT000332257_05.4.
DR   H-InvDB; HIT000332257_06.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1204
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:9606"
FT   gene            1..1204
FT                   /gene="AGER"
FT   CDS             11..1183
FT                   /codon_start=1
FT                   /gene="AGER"
FT                   /product="receptor for advanced glycosylation end-products
FT                   deletion exon 3 variant"
FT                   /note="RAGEdelex3; alternatively spliced; transmembrane
FT                   receptor splice variant; has deletion within ligand-binding
FT                   domain"
FT                   /db_xref="GOA:Q15109"
FT                   /db_xref="H-InvDB:HIT000332257_03.4"
FT                   /db_xref="HGNC:HGNC:320"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1PWI"
FT                   /db_xref="PDB:2BJP"
FT                   /db_xref="PDB:2E5E"
FT                   /db_xref="PDB:2ENS"
FT                   /db_xref="PDB:2L7U"
FT                   /db_xref="PDB:2LE9"
FT                   /db_xref="PDB:2LMB"
FT                   /db_xref="PDB:2M1K"
FT                   /db_xref="PDB:2MJW"
FT                   /db_xref="PDB:2MOV"
FT                   /db_xref="PDB:3CJJ"
FT                   /db_xref="PDB:3O3U"
FT                   /db_xref="PDB:4LP4"
FT                   /db_xref="PDB:4LP5"
FT                   /db_xref="PDB:4OF5"
FT                   /db_xref="PDB:4OFV"
FT                   /db_xref="PDB:4OI7"
FT                   /db_xref="PDB:4OI8"
FT                   /db_xref="PDB:4P2Y"
FT                   /db_xref="PDB:4XYN"
FT                   /db_xref="PDB:4YBH"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q15109"
FT                   /protein_id="AAX07277.1"
FT                   /translation="MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKP
FT                   PQRLEWKLGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVY
FT                   QIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQT
FT                   RRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLE
FT                   EVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQD
FT                   QGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTA
FT                   ALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP"
XX
SQ   Sequence 1204 BP; 264 A; 340 C; 392 G; 208 T; 0 other;
     aggaagcagg atggcagccg gaacagcagt tggagcctgg gtgctggtcc tcagtctgtg        60
     gggggcagta gtaggtgctc aaaacatcac agcccggatt ggcgagccac tggtgctgaa       120
     gtgtaagggg gcccccaaga aaccacccca gcggctggaa tggaaactgg gaggaggccc       180
     ctgggacagt gtggctcgtg tccttcccaa cggctccctc ttccttccgg ctgtcgggat       240
     ccaggatgag gggattttcc ggtgccaggc aatgaacagg aatggaaagg agaccaagtc       300
     caactaccga gtccgtgtct accagattcc tgggaagcca gaaattgtag attctgcctc       360
     tgaactcacg gctggtgttc ccaataaggt ggggacatgt gtgtcagagg gaagctaccc       420
     tgcagggact cttagctggc acttggatgg gaagcccctg gtgcctaatg agaagggagt       480
     atctgtgaag gaacagacca ggagacaccc tgagacaggg ctcttcacac tgcagtcgga       540
     gctaatggtg accccagccc ggggaggaga tccccgtccc accttctcct gtagcttcag       600
     cccaggcctt ccccgacacc gggccttgcg cacagccccc atccagcccc gtgtctggga       660
     gcctgtgcct ctggaggagg tccaattggt ggtggagcca gaaggtggag cagtagctcc       720
     tggtggaacc gtaaccctga cctgtgaagt ccctgcccag ccctctcctc aaatccactg       780
     gatgaaggat ggtgtgccct tgccccttcc ccccagccct gtgctgatcc tccctgagat       840
     agggcctcag gaccagggaa cctacagctg tgtggccacc cattccagcc acgggcccca       900
     ggaaagccgt gctgtcagca tcagcatcat cgaaccaggc gaggaggggc caactgcagg       960
     ctctgtggga ggatcagggc tgggaactct agccctggcc ctggggatcc tgggaggcct      1020
     ggggacagcc gccctgctca ttggggtcat cttgtggcaa aggcggcaac gccgaggaga      1080
     ggagaggaag gccccagaaa accaggagga agaggaggag cgtgcagaac tgaatcagtc      1140
     ggaggaacct gaggcaggcg agagtagtac tggagggcct tgaggggccc acagacagat      1200
     ccca                                                                   1204
//