spacer

EBI Dbfetch

ID   AY749637; SV 1; linear; mRNA; STD; MUS; 1466 BP.
XX
AC   AY749637;
XX
DT   03-OCT-2004 (Rel. 81, Created)
DT   22-JUN-2005 (Rel. 84, Last updated, Version 2)
XX
DE   Mus musculus CXC chemokine receptor 1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1466
RX   DOI; 10.1016/j.cyto.2005.02.005.
RX   PUBMED; 15967374.
RA   Fu W., Zhang Y., Zhang J., Chen W.F.;
RT   "Cloning and characterization of mouse homolog of the CXC chemokine
RT   receptor CXCR1";
RL   Cytokine 31(1):9-17(2005).
XX
RN   [2]
RP   1-1466
RA   Fu W., Chen W.;
RT   ;
RL   Submitted (13-SEP-2004) to the INSDC.
RL   Dept. of Immunology, Peking University Health Science Center, 38 Xueyuan
RL   Road, Beijing 100083, P.R. China
XX
DR   MD5; 368de01c252f8b710cfe2b825cd1ec6c.
DR   Ensembl-Gn; ENSMUSG00000048480; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053389; mus_musculus.
DR   EuropePMC; PMC1082905; 15790398.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1466
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             375..1430
FT                   /codon_start=1
FT                   /product="CXC chemokine receptor 1"
FT                   /note="CXCR1; G protein-coupled seven transmembrane (7-TM)
FT                   receptor; involved in chemotaxis"
FT                   /db_xref="GOA:Q810W6"
FT                   /db_xref="InterPro:IPR000174"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR001355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2448715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810W6"
FT                   /protein_id="AAU87365.1"
FT                   /translation="MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQ
FT                   ALVVFYALVSLLSLLGNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSK
FT                   LKGWIFGTPLCKMVSLLKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCV
FT                   GIWGLSLILSLPFAIFRQAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLT
FT                   MLVCYGLTLRMLFKTHMRQKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDT
FT                   CERRNDIDQALYITEILGFSHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRR
FT                   VAFHTSLTAIY"
XX
SQ   Sequence 1466 BP; 342 A; 369 C; 337 G; 418 T; 0 other;
     cttccgtttg ctgtgtgctg gctcttccct gagtgtaaga acaacctggt gactgtatct        60
     gaacccaggg gcgtggctga ggacaaagat ggttaagagg agacaaggaa gagctgggca       120
     tagagttgag aactgtagag ccaactgaag gcaaaggtat ctcccatggg ttttattcta       180
     tactcagact gactgtccaa ggactttgac agcattagga agctaaccta ccaaagttca       240
     agttgaaggc aaagggggtg aactttggtt gtcaaggcaa cagagaagcc aatactaccc       300
     cctcaacact cacaacactt gaatttggtt actaaatctt atctctcttt cttacctttc       360
     acctagatca aacaatggcc gaggctgaat atttcatctg gactaatcct gagggtgact       420
     ttgagaaaga atttggaaat atcacgggaa tgctgcccac tggagattat ttcatcccct       480
     gtaagagagt tccaataacc aacaggcagg ctttagttgt cttttatgca ctggtgtccc       540
     ttctgagctt gctgggaaac tcgctggtga tgctggttat cttatacagg cgaaggaccc       600
     gatccgtcat ggatgtctac gtgctgaacc tagccatcgc cgacctactc ttttcattga       660
     ccctgccctt cttggctgtc tccaaattga agggctggat ttttggcaca cccctgtgca       720
     agatggtctc actcctgaag gaattcaact tcttcagtgg tatcctgctg ctggcctgca       780
     tcagtgtgga ccgatacctg gccatcgtcc atgccacccg tacgctggcc cgaaagcgct       840
     acttggttaa attcgtgtgc gtgggcatct ggggtctatc tttgattctg tctctgcctt       900
     ttgctatctt ccgccaggca tataaaccat tccgttctgg tacagtctgc tatgaagtcc       960
     tgggtgaagc cacaacagat tttcggatga ccttgcgggg tctgtcccac atatttggct      1020
     tcctcctgcc gctgctcact atgctggtct gctacgggct cacactgcgc atgctcttta      1080
     agacccacat gaggcagaaa caccgggcca tgggggtgat ctttgctgtt gtgttggtct      1140
     tcttgctctg ttgtctgccc tacaatctgg ttctgctctc agacactctc ttaggagccc      1200
     acttgattga agatacttgc gaacgccgca atgacattga ccaggccctg tatattactg      1260
     agatcctggg cttttctcat agttgtctta accctatcat ctatgccttc gttggccaaa      1320
     attttcgcca tgaattcctc aagatccttg ctaaccatgg cctggttcgc aaggaggttt      1380
     tgacacaccg ccgtgttgcc tttcatacgt ctctcaccgc tatttattaa acctctgaga      1440
     attcccggaa aaaaaaaaaa aaaaaa                                           1466
//


spacer
spacer