spacer

EBI Dbfetch

ID   AY648999; SV 1; linear; genomic DNA; STD; HUM; 504 BP.
XX
AC   AY648999;
XX
DT   13-JUL-2004 (Rel. 80, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens DJ-1 (PARK7) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-504
RA   Zou H.Q., Chan P.;
RT   "DJ-1 gene G150S mutation";
RL   Unpublished.
XX
RN   [2]
RP   1-504
RA   Zou H.Q., Chan P.;
RT   ;
RL   Submitted (09-JUN-2004) to the INSDC.
RL   Beijing Institute of Geriatrics, Xuanwu Hospital, Capital University of
RL   Medical Sciences, 45 Changchun Street, Beijing 100053, China
XX
DR   MD5; bd798db0773ac47de8c6be31362fe705.
DR   Ensembl-Gn; ENSG00000116288; homo_sapiens.
DR   Ensembl-Tr; ENST00000338639; homo_sapiens.
DR   Ensembl-Tr; ENST00000377488; homo_sapiens.
DR   Ensembl-Tr; ENST00000377491; homo_sapiens.
DR   Ensembl-Tr; ENST00000493373; homo_sapiens.
DR   Ensembl-Tr; ENST00000493678; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..504
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /map="1p36"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>206
FT                   /gene="PARK7"
FT   mRNA            <46..>206
FT                   /gene="PARK7"
FT                   /product="DJ-1"
FT   CDS             <46..206
FT                   /codon_start=3
FT                   /gene="PARK7"
FT                   /product="DJ-1"
FT                   /db_xref="GOA:Q99497"
FT                   /db_xref="HGNC:HGNC:16369"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1J42"
FT                   /db_xref="PDB:1P5F"
FT                   /db_xref="PDB:1PDV"
FT                   /db_xref="PDB:1PDW"
FT                   /db_xref="PDB:1PE0"
FT                   /db_xref="PDB:1Q2U"
FT                   /db_xref="PDB:1SOA"
FT                   /db_xref="PDB:1UCF"
FT                   /db_xref="PDB:2OR3"
FT                   /db_xref="PDB:2R1T"
FT                   /db_xref="PDB:2R1U"
FT                   /db_xref="PDB:2R1V"
FT                   /db_xref="PDB:2RK3"
FT                   /db_xref="PDB:2RK4"
FT                   /db_xref="PDB:2RK6"
FT                   /db_xref="PDB:3B36"
FT                   /db_xref="PDB:3B38"
FT                   /db_xref="PDB:3B3A"
FT                   /db_xref="PDB:3BWE"
FT                   /db_xref="PDB:3CY6"
FT                   /db_xref="PDB:3CYF"
FT                   /db_xref="PDB:3CZ9"
FT                   /db_xref="PDB:3CZA"
FT                   /db_xref="PDB:3EZG"
FT                   /db_xref="PDB:3F71"
FT                   /db_xref="PDB:3SF8"
FT                   /db_xref="PDB:4BTE"
FT                   /db_xref="PDB:4MNT"
FT                   /db_xref="PDB:4MTC"
FT                   /db_xref="PDB:4N0M"
FT                   /db_xref="PDB:4N12"
FT                   /db_xref="PDB:4OGF"
FT                   /db_xref="PDB:4OQ4"
FT                   /db_xref="PDB:4P2G"
FT                   /db_xref="PDB:4P34"
FT                   /db_xref="PDB:4P35"
FT                   /db_xref="PDB:4P36"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99497"
FT                   /protein_id="AAT68961.1"
FT                   /translation="HYTYSENRVEKDSLILTSRGPGTSFEFALAIVEALNGKEVAAQVK
FT                   APLVLKD"
FT   variation       84
FT                   /gene="PARK7"
FT                   /replace="g"
FT                   /note="in wild type; results in a serine to glycine
FT                   substitution"
XX
SQ   Sequence 504 BP; 131 A; 110 C; 109 G; 154 T; 0 other;
     cacatagccc attaggatgt caccttttct gtttctactt tgcaggtcat tacacctact        60
     ctgagaatcg tgtggaaaaa gacagcctga ttcttacaag ccgggggcct gggaccagct       120
     tcgagtttgc gcttgcaatt gttgaagccc tgaatggcaa ggaggtggcg gctcaagtga       180
     aggctccact tgttcttaaa gactagagca gcgaactgcg acgatcactt agagaaacag       240
     gccgttagga atccattctc actgtgttcg ctctaaacaa aacagtggta ggttaatgtg       300
     ttcagaagtc gctgtcctta ctacttttgc ggaagtatgg aagtcacaac tacacagaga       360
     tttctcagcc tacaaattgt gtctatacat ttctaagcct tgtttgcaga ataaacaggg       420
     catttagcaa actactgatt gtttcttgtt ttgtctctca tttcttttgt gaaattaaat       480
     tccgtatcac cttcatttgc agct                                              504
//


spacer
spacer