spacer

EBI Dbfetch

ID   AY648975; SV 1; linear; mRNA; STD; MUS; 2103 BP.
XX
AC   AY648975;
XX
DT   11-JUL-2004 (Rel. 80, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus neuregulin-1 type III beta1-a (Nrg1) mRNA, complete cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2103
RA   Anton E.S., Ghashghaei H.T., Weber J.L., McCann C., Fischer T.M.,
RA   Cheung I.D., Gassmann M., Messing A., Klein R., Schwab M.H., Lloyd K.C.,
RA   Lai C.;
RT   "Inactivation of the receptor tyrosine kinase ErbB4 disrupts neuroblast
RT   migration and placement in the adult forebrain";
RL   Unpublished.
XX
RN   [2]
RP   1-2103
RA   Fischer T.M., Lai C.;
RT   ;
RL   Submitted (09-JUN-2004) to the INSDC.
RL   Dept. of Neuropharmacology, The Scripps Research Institute, 10550 North
RL   Torrey Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 55663f77a31c96c04b5d6cc3f42db779.
DR   Ensembl-Gn; ENSMUSG00000062991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073884; mus_musculus.
DR   EuropePMC; PMC2919805; 20610754.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2103
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /strain="C57/Bl6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2103
FT                   /gene="Nrg1"
FT   CDS             1..2103
FT                   /codon_start=1
FT                   /gene="Nrg1"
FT                   /product="neuregulin-1 type III beta1-a"
FT                   /note="SMDF; alternatively spliced"
FT                   /db_xref="GOA:Q6DR99"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002154"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018250"
FT                   /db_xref="MGI:MGI:96083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DR99"
FT                   /protein_id="AAT68240.1"
FT                   /translation="MEIYPPDMSEGAGGRSSSPSTQLSADPSLDGLPAAEHMPDTHTED
FT                   GRSPGLLGLAVPCCVCLEAERLRGCLNSEKICIVPILACLVSLCLCIAGLKWVFVDKIF
FT                   EYDSPTHLDPGGLGQDPVISLDPTAASAVLVSSEAYTSPVSKAQSEAEAHVTGQGDHVA
FT                   VASEPSAVPTRKNRLSAFPPLHSTPPPFPSPARTPEVRTPKSGTQPQTTETNLQTAPKL
FT                   STSTSTTGTSHLIKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVM
FT                   ASFYKHLGIEFMEAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRQKLHDRLRQ
FT                   SLRSERNNMVNIANGPHHPNPPPENVQLVNQYVSKNVISSEHIVEREVETSFSTSHYTS
FT                   TAHHSTTVTQTPSHSWSNGHTESIISESHSVIMMSSVENSRHSSPAGGPRGRLHGLGGP
FT                   RECNSFLRHARETPDSYRDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVS
FT                   SMTVSMPSVAVSPFVEEERPLLLVTPPRLREKKYDHHPQQLNSFHHNPAHQSTSLPPSP
FT                   LRIVEDEEYETTQEYEPIQEPIKKVTNSRRAKRTKPNGHIANRLEMDSNPSSVSSNSES
FT                   ETEDERVGEDTPFLGIQNPLAASLEVAPAFRLAESRTNPAGRFSTQEELQARLSSVIAN
FT                   QDPIAV"
XX
SQ   Sequence 2103 BP; 543 A; 610 C; 508 G; 442 T; 0 other;
     atggagattt atcccccaga catgtctgag ggagctggcg ggaggtcctc cagcccctcc        60
     actcagctga gtgcagaccc atctctcgat gggcttccgg cagcggaaca tatgccagac       120
     acccacacag aagatgggag aagccctgga ctcctgggcc tggccgtgcc ctgctgtgtc       180
     tgcctggaag cggagcgtct cagagggtgc ctcaactccg agaagatctg cattgttccc       240
     attctggctt gtctagtaag cctctgcctc tgcattgctg gcctaaagtg ggtatttgtg       300
     gacaagatat tcgaatacga ctctcctacc caccttgacc ctggggggtt aggccaggac       360
     cctgttattt ctctggatcc aacggctgcc tccgctgttc tggtctcatc cgaggcatac       420
     acttcacctg tctctaaggc tcagtctgaa gccgaggctc atgttacagg gcaaggtgac       480
     catgtcgctg tggcctctga accttccgca gtacccaccc ggaagaaccg gctgtctgct       540
     tttcctccct tacactccac tccaccgccc ttcccttctc cagctcggac ccctgaggtg       600
     agaacaccca agtcaggaac tcagccacaa acaacagaaa ctaatctgca aactgctcct       660
     aaactttcca catctacatc cacgactggg accagccatc tcataaagtg tgcggagaag       720
     gagaaaactt tctgtgtgaa tggaggcgag tgcttcatgg tgaaggacct gtcaaacccc       780
     tcaagatact tgtgcaagtg cccaaatgag tttactggtg atcgttgcca aaactacgta       840
     atggccagct tctacaagca tcttgggatt gaatttatgg aagcggagga gctctaccag       900
     aagagggtac tgacaattac tggcatctgt atcgccctgt tggtggtcgg catcatgtgt       960
     gtggtggcct actgcaaaac caagaaacag cggcagaagc ttcatgatcg gctccggcag      1020
     agccttcggt cagaacgaaa caacatggtg aacatagcga atggccctca ccatccaaac      1080
     ccaccaccag agaatgtgca actggtgaat caatatgtat ctaaaaacgt catctccagt      1140
     gagcatattg tggagagaga agtggagacc tccttttcca ccagtcacta cacttccaca      1200
     gctcatcact ccacgactgt cacccagact cctagtcaca gctggagtaa tgggcacaca      1260
     gaaagcatca tttcagaaag ccactctgta atcatgatgt catcggtaga gaacagcagg      1320
     cacagcagcc cagctggggg cccacgagga cgtcttcatg gcctgggagg ccctcgcgaa      1380
     tgtaacagct tcctcaggca tgccagagaa acccctgact cctacagaga ctctcctcat      1440
     agtgaaaggt atgtatcagc catgaccacc ccggctcgta tgtcacctgt agatttccac      1500
     acgccaagct cccctaaatc gcccccttcg gaaatgtctc cacccgtgtc cagcatgacg      1560
     gtgtccatgc cctctgtggc agtcagcccc tttgtggaag aagagaggcc tctgcttctt      1620
     gtgacgccac cgaggctacg ggagaagaag tatgatcatc acccccagca actcaactcc      1680
     tttcatcaca accctgcaca tcagagtacc agcctccccc ctagcccatt gaggatagtg      1740
     gaggatgagg aatacgaaac gacccaggag tatgagccaa ttcaagagcc tattaagaaa      1800
     gtcaccaata gccggcgggc caaaagaacc aagcccaatg gccacattgc caataggttg      1860
     gaaatggaca gcaacccaag ttctgtgagc agtaactcag aaagtgagac agaagatgaa      1920
     agagtaggtg aagatacacc attcctgggc atacagaacc ccctggcagc cagccttgag      1980
     gtggcccctg ccttccgtct ggctgagagc aggactaacc cagcaggccg cttctccaca      2040
     caggaagaat tacaggccag gctgtctagt gtaatcgcta accaagaccc tattgctgta      2100
     taa                                                                    2103
//


spacer
spacer