spacer

EBI Dbfetch

ID   AY622969; SV 1; linear; mRNA; STD; MUS; 207 BP.
XX
AC   AY622969;
XX
DT   22-JUN-2004 (Rel. 80, Created)
DT   29-NOV-2004 (Rel. 81, Last updated, Version 3)
XX
DE   Mus musculus matrix metalloproteinase 9 (Mmp9) mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-207
RA   Ulrich R., Gerhauser I., Seeliger F., Baumgaertner W., Alldinger S.;
RT   "Expression profile of matrix-metalloproteinases and their inhibitors in
RT   actue and chronic demyelinating Theiler's murine encephalomyelitis";
RL   Acta Neuropathol. 108(4):366-366(2004).
XX
RN   [2]
RP   1-207
RA   Ulrich R.G., Seeliger F., Alldinger S., Baumgaertner W.;
RT   ;
RL   Submitted (07-MAY-2004) to the INSDC.
RL   Veterinaer-Pathologie, Justus-Liebig-Universitaet-Giessen, Frankfurter
RL   Strasse 96, Giessen, Hessen 35392, Germany
XX
DR   MD5; df7ff02bd16efd39b569ee1947c73cf3.
DR   Ensembl-Gn; ENSMUSG00000017737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017881; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..207
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="uterus"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>207
FT                   /gene="Mmp9"
FT   CDS             <1..>207
FT                   /codon_start=3
FT                   /gene="Mmp9"
FT                   /product="matrix metalloproteinase 9"
FT                   /db_xref="GOA:Q6GXA2"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR028688"
FT                   /db_xref="MGI:MGI:97011"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GXA2"
FT                   /protein_id="AAT46400.1"
FT                   /translation="SPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPF
FT                   LTARTWPALPATLDSAFEDPQTK"
XX
SQ   Sequence 207 BP; 43 A; 58 C; 55 G; 51 T; 0 other;
     tgagtccggc agacaatcct tgcaatgtgg atgtttttga tgctattgct gagatccagg        60
     gcgctctgca tttcttcaag gacggttggt actggaagtt cctgaatcat agaggaagcc       120
     cattacaggg ccccttcctt actgcccgca cgtggccagc cctgcctgca acgctggact       180
     ccgcctttga ggatccgcag accaaga                                           207
//


spacer
spacer