spacer

EBI Dbfetch

ID   AY574261; SV 1; linear; mRNA; STD; MUS; 1539 BP.
XX
AC   AY574261;
XX
DT   20-APR-2004 (Rel. 79, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus neuronal nicotinic acetylcholine receptor alpha2 subunit mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1539
RA   Groot-Kormelink P.J.;
RT   ;
RL   Submitted (16-MAR-2004) to the INSDC.
RL   of Pharmacology, University College London, Gower Street, London WC1E 6BT,
RL   United Kingdom
XX
DR   MD5; c455520de9507234a7be10566c7badf1.
DR   Ensembl-Gn; ENSMUSG00000022041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022620; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1539
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="9-11 weeks old"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1539
FT                   /codon_start=1
FT                   /product="neuronal nicotinic acetylcholine receptor alpha2
FT                   subunit"
FT                   /db_xref="GOA:Q91X60"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:87886"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91X60"
FT                   /protein_id="AAS90357.1"
FT                   /translation="MAPSHPAFQFWIHLYLWCLLLMPAVLAQQGSHTHAEDRLFKHLFG
FT                   GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEF
FT                   GNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSID
FT                   VTFFPFDQQNCKMKFGSWTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKY
FT                   DCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVL
FT                   LSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMP
FT                   NWVRVALLGRVPRWLMMNRPLPPMELHGSPGLKLSPTYHWLETNMDAEEREETEEEEEE
FT                   EEDENICMCAGLPDSSMGVLYGHGSLHLRAMGPEAKTPSQASEILLSPQIQKALEGVHY
FT                   IADHLRSEDADSSVKEDWKYVAMVVDRIFLWLFIIVCFLGTIGLFLPPFLAGMI"
XX
SQ   Sequence 1539 BP; 333 A; 462 C; 391 G; 353 T; 0 other;
     atggccccct cccatcctgc tttccagttc tggatacatc tttatctctg gtgtctgctt        60
     ctgatgccag cagtgttggc ccagcaaggc tcgcacaccc atgccgagga ccgcctgttc       120
     aaacacctct ttggaggcta caatcgctgg gcacggccag tgcccaacac ttccgatgtg       180
     gtcatcgtgc gctttggact atccattgca cagctcatag atgtggatga gaagaatcaa       240
     atgatgacca ccaatgtctg gctaaagcag gaatggaatg actacaagct gcgctgggac       300
     ccggctgagt ttggcaacat cacctccctc cgcgtcccct cagagatgat ctggatccca       360
     gacattgttc tctacaacaa tgcagacggg gagtttgcgg tgacccacat gaccaaggcc       420
     cacctcttct tcacgggcac tgtgcactgg gtgcccccag ccatctacaa gagctcctgc       480
     agcatcgacg tgactttctt ccccttcgac cagcagaact gcaagatgaa gtttggctcc       540
     tggacatacg acaaggccaa gatcgacctg gagcagatgg agcggacggt ggacctgaag       600
     gactactggg agagcggcga gtgggccatt atcaacgcca ccggaaccta taacagcaag       660
     aagtacgact gctgcgcgga gatctacccc gacgtcacct actacttcgt tatccgccgg       720
     ctgccgctgt tctacaccat caacctcatt atcccgtgcc tgctcatctc ctgcctcacc       780
     gtgctcgtgt tctacttgcc ctctgagtgt ggagagaaga tcacgctgtg catctcggtg       840
     ctgctctccc tcactgtctt cctgctgctc atcacagaaa ttatcccatc cacctcactg       900
     gtcatcccac tcatcggcga gtacctgctc ttcaccatga tcttcgtcac cctctctatt       960
     gtgatcacag tcttcgtgct caatgtccac caccgttccc ctagcacgca caacatgccc      1020
     aactgggtga gggtggccct gctaggccgg gtgccccggt ggctgatgat gaatcggccc      1080
     ctgccgccca tggagctcca tggctctcca ggtctgaagc tcagccccac ttatcattgg      1140
     ctggagacca acatggatgc tgaagaaagg gaggagacag aggaagagga ggaggaggaa      1200
     gaagatgaaa acatatgtat gtgtgcaggc ctcccagact cttccatggg tgtcctctat      1260
     ggccatggca gcctgcatct gagggccatg gggcctgagg ccaagactcc atcccaggct      1320
     agtgagatcc tgctgtcacc tcaaatacag aaagcactag aaggtgtaca ctacattgct      1380
     gaccacctga ggtctgagga tgctgactct tcggtgaagg aagattggaa gtatgtggcc      1440
     atggtggtag accggatctt cctctggctg ttcattatcg tctgcttcct ggggaccatc      1500
     gggctcttcc tccctccgtt cctggctgga atgatctga                             1539
//


spacer
spacer