Dbfetch

ID   AY528242; SV 1; linear; mRNA; STD; MUS; 4486 BP.
XX
AC   AY528242;
XX
DT   08-MAR-2004 (Rel. 79, Created)
DT   18-NOV-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus neuronal cell adhesion molecule short isoform (Nrcam) mRNA,
DE   complete cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-4486
RX   PUBMED; 16123759.
RA   Ishiguro H., Liu Q.R., Gong J.P., Hall F.S., Ujike H., Morales M.,
RA   Sakurai T., Grumet M., Uhl G.R.;
RT   "NrCAM in Addiction Vulnerability: Positional Cloning, Drug-Regulation,
RT   Haplotype-Specific Expression, and Altered Drug Reward in Knockout Mice";
RL   Neuropsychopharmacology 0:0-0(2005).
XX
RN   [2]
RP   1-4486
RA   Liu Q.-R., Uhl G.R.;
RT   ;
RL   Submitted (16-JAN-2004) to the INSDC.
RL   Molecular Neurobiology Branch, National Institute on Drug Abuse/NIH, 333
RL   Cassell Drive, Baltimore, MD 21224, USA
XX
DR   MD5; 92ab2bed4cdfa8b8cc9385c569935f46.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4486
FT                   /organism="Mus musculus"
FT                   /chromosome="12"
FT                   /map="12A3"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..4486
FT                   /gene="Nrcam"
FT   CDS             570..1106
FT                   /codon_start=1
FT                   /gene="Nrcam"
FT                   /product="neuronal cell adhesion molecule short isoform"
FT                   /note="NrCAM; alternatively spliced"
FT                   /db_xref="GOA:Q6QRP1"
FT                   /db_xref="InterPro:IPR026966"
FT                   /db_xref="MGI:MGI:104750"
FT                   /db_xref="UniProtKB/TrEMBL:Q6QRP1"
FT                   /protein_id="AAS48508.1"
FT                   /translation="MPGTAYKVRVGAEGDSGFVSSEDVFETGPAMASRQVDIATQGWFI
FT                   GLMCAVALLILILLIVCFIRRNKGGKYPVKEKEDAHADPEIQPMKEDDGTFGEYSDAED
FT                   HKPLKKGSRTPSDRTVKKEDSDDSLVDYGEGVNGQFNEDGSFIGQYSGKKEKEPAEGNE
FT                   SSEAPSPVNAMNSFV"
FT   regulatory      2536..2541
FT                   /gene="Nrcam"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2569
FT                   /gene="Nrcam"
FT   regulatory      2664..2669
FT                   /gene="Nrcam"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2694
FT                   /gene="Nrcam"
FT   regulatory      3213..3218
FT                   /gene="Nrcam"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3228
FT                   /gene="Nrcam"
FT   regulatory      4471..4476
FT                   /gene="Nrcam"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4486
FT                   /gene="Nrcam"
XX
SQ   Sequence 4486 BP; 1283 A; 945 C; 970 G; 1288 T; 0 other;
     ttcttcttga cctttggtag atcatgtttg accacagcat ttgtacctgt tcctctaaaa        60
     tatgctaact attcaacatt atctaatgtg tgagtttctc agcttttaag attctctggc       120
     tgtgacttaa aataagtcag aagtcactat tatagaaaat attctttctc ctcccagggt       180
     aaattctctg aatacctgca attagaagcc aaataaaatg gaaaagtacc caaagtacct       240
     ggaagtctct gatacactct aatagcttct gttctcagga cagttcatca atccccggat       300
     gtccatcagt aaatgaagat ggcgatgttt attgggactg gacctaatgg gaagcagttt       360
     acattactca gaaaacattc cgtgcagtaa accccaggat cagcaatctc actgccacag       420
     ctgccgagac gtatgccaat atcacttggg agtatgaggg accaggacat gtgacgtttt       480
     atgttgaata tggtgtagca ggcagcaaag aagaatggag gaaagaaatt gtaaatggtt       540
     ctcgaagctt ctttgggtta aagggtctaa tgccaggaac agcatacaaa gttcgagttg       600
     gtgctgaggg ggactctggt tttgtgagtt cagaggatgt gtttgagaca ggaccagcaa       660
     tggcaagccg gcaagtggat atcgcgaccc aaggctggtt cataggtcta atgtgcgctg       720
     ttgctctcct catcttaatt ttgctgattg tttgcttcat cagaagaaac aaaggtggta       780
     aatacccagt taaagaaaag gaggatgctc atgcagaccc tgaaatccag cccatgaagg       840
     aagatgatgg gacgtttgga gaatacagtg atgcagaaga tcacaagcct ttgaaaaaag       900
     gaagtcgaac accttcagac aggactgtga aaaaagaaga tagcgatgat agtctggttg       960
     actatggaga gggggtgaac ggccaattca acgaggatgg ctcctttatt ggccaataca      1020
     gtggtaagaa agagaaagag ccagcagagg gaaatgaaag ctcagaggcc ccttctcctg      1080
     tcaacgcgat gaactccttt gtttaagtct ttaagctctc tgccaatgtc taatctctct      1140
     ggaatggttt tcctgaacac ctgtcatccc tctcatacta cggacatatg ggtagaaaga      1200
     atgttttttc cggtatatga gtattatgag accagagcaa gaacatgact cagtcaaatg      1260
     atacattaat atgaactggg gtgcaaagtg catacgtttt tgttcagagt ggggtttttc      1320
     tcaatttcct tggaactgat taaaaagaaa tacaaacatc atcaatagat tacattattc      1380
     cctgtgcggg atccagttca atacgatgca tgagacatgc tgcacagagg acacacctgt      1440
     gtatgtgact gcgatgtggt tgggtacttt gttggcacta tcctcagctg atccctaaat      1500
     atgaattccg ttgtcattgt gaagagtgtt gctgtagtgt tctctagagc ttcaatgtct      1560
     ctgtggacat tgttgttaaa ctcgtgacta tgtctagctg gtgttagtct ttttgagaga      1620
     ctattaggaa cagtgtgtac agtatatact tgctacatga gttacttatg acagttgcat      1680
     ccactaatgc tcgctgagac tctgaaacct gttctttgct cccggacctt cctaggcttt      1740
     ttatccttcc gggtgtcaca gcagcagagt cccacttact atactatctg cgttcagtcc      1800
     tttggggggc ataaacattg cgtattgtga cacctgctgg catttgtgcc ctactcaaag      1860
     aattgaagtc aaagctctca agtgaaattt taaattttag ttcagaaaat gcagggcaag      1920
     acacacgcag tgccttcaga caattagcat tccctgactc ctgtactctg tatcagccag      1980
     tgtgggcaac ttcatcctac gctactgttg ttggaaagga acttttccaa ggcagagata      2040
     attcgaactg aaactgggag cataggaaca actttatttg aagtggtgtt ccccacacaa      2100
     atatcaggcc tccaaagctc tgtcattgtc gggtgtacag gatggttttg ttgtcttttg      2160
     tggtttctag ccaaacaagt caagttgaaa aaaggaaaaa atggtatggt tggaaatgga      2220
     tagaaaaccc aatgattgca gaagtaaaag cgtacaacag catgcctaaa gtactaaatg      2280
     attcactctg cctagacaag ctttcaaatt ccgcagcatt cagcaacgtg tatgcaaatt      2340
     gcaacaggca cactccagaa cctgagaaac ctgaccagtg cttaattagg ccagcagtca      2400
     aagagattac acctcgagtc taaagaacaa tactatatcc tatcatagcc ataaacaatg      2460
     tgtgtgaaat ggcttacctc caatatagaa acctatgacc acctatggtt gaagggatgc      2520
     tcagtttcat ttgccaataa attggtttct cataacttgc atcaagttta attttaagta      2580
     aagcctttta tatgtaggta ttctgttgaa tttgtaaata tacttagagt gtagaagcta      2640
     tatgctcata ggtattacgt gcaaataaac atgcaatcaa tgtttatgtt ctcctgtgtg      2700
     agaagcaggc tagttgatga atgtagtagt atgtgggacg aggaaacatc caaatgtctt      2760
     tcgtggtgtt tcggatttaa tttttttccc cactctattt ttgtttgtga aactgaaata      2820
     gtgaactccg tgccccccac ccctttcttc agcctgttgc tggctgaaag cctcagtgtt      2880
     ttgccaatgg agtacattag ggtttgccac ctgacacctt tgatgtgtac aggtaaagct      2940
     tgttttaaag tgattcccca aatgaagtgg ccctaaatac tctcatcttt tcatattcac      3000
     tctccacaaa ctagcctatc gattgaaaat acaaaataac acacaggctt gcctcaacat      3060
     aacaaagcac aaagacaaaa gttcctttca agtcatcaat gccttcagtg aaagacaaat      3120
     gtgaagtctc tgctcatcta taactatgga tgctaaattt ctctgtgcat gaagaagtca      3180
     cgcctgtaga taactacaga ttttctatta aaaatgaaaa attgagtgtg gttttaaagc      3240
     cccccccccc cactccttgt acttagtcat gttccctggg ggggggggtg gggggagggt      3300
     gggtgtgtag caggtgtacc cggcagcaca atgcttgtgg acttccatct gaaaagggaa      3360
     tggtaaacag cccagctctc ctcagtttca ggttcttcaa acctgtactt ccaaagattt      3420
     ttgaacaaat tcagacaatt ttgtttcgtt tttaaaaaga ctttggattt tatcgccaac      3480
     gtaaaaataa gaattagaat caggaattat tttttttttt ccgagacagg gtttctctgt      3540
     gtagtcttgg ctgtcctgga actcattctg cagaccaggc tggcctggaa ctcagaaatc      3600
     tgcctgcctc tgcttcccaa gtgctgggaa aggcgtgagc caccaccgcc cggtgaaatc      3660
     aggaactttt aaatcaaagg ttagggctag ttacgcagga atagatagca agagtccttt      3720
     gaaaacaggt gaacaaatct ggttcctttg tcgagtctca caatagacca actgctggtg      3780
     ccctgtccat acaaccagtg ggacctcctc gctactcagc catggtcaat ttatatttct      3840
     taacatggct acatgatgag agtttgaaca ctcatacata ttacaaatat gtcatctgct      3900
     tccttttctc caccttcatt cttctgtctc catccaagcc tagcaattat ccacattcca      3960
     ccacttgccc cttggtcact gacccctggt cccagcagtg catccaggag aactacctgc      4020
     cttgtgctct cagagttatt tagacagcat gctatgaaag tgaatcggag atgccataga      4080
     gagagagctc agaattcctc tcacagagga catgttggct gctttctcgg accctccctt      4140
     ctgtcctcac tgtgggccaa attaacaaac cttagcctca ctctacatca tgacacggct      4200
     ccgtggcaac aggaactttg aaactttaag catgacctca gaaaaaatct tgtagttata      4260
     aacctttata aaccatcttc ttcattgggt tttaaggact ttcgaggtaa ggggagtcta      4320
     agaactcagg gattttcagt cacaaaatga gtcacttccg cttgagatgt ttccgcagct      4380
     gaccaccaga gggcgcctgt gctttatcct gcgtcgaaga aacttgctag agaaagcagg      4440
     ctaatgaccc tggctggatc ggttttggat aattaaatga tgaccc                     4486
//