Dbfetch

ID   AY509002; SV 1; linear; mRNA; STD; MUS; 3005 BP.
XX
AC   AY509002;
XX
DT   19-JAN-2004 (Rel. 78, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus strain CD1 frizzled 10 (Fz10) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3005
RX   DOI; 10.1007/s00427-004-0386-4.
RX   PUBMED; 14758554.
RA   Nunnally A.P., Parr B.A.;
RT   "Analysis of Fz10 expression in mouse embryos";
RL   Dev. Genes Evol. 214(3):144-148(2004).
XX
RN   [2]
RP   1-3005
RA   Parr B., Nunnally A.;
RT   ;
RL   Submitted (18-DEC-2003) to the INSDC.
RL   MCD Biology, University of Colorado, 347 UCB, Boulder, CO 80309-0347, USA
XX
DR   MD5; 46f6108feaa22be40ca2afd84742bdc3.
DR   Ensembl-Gn; ENSMUSG00000081683; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030119; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030086; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030096; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029813; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030549; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029222; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029783; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029933; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029889; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030022; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029920; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030590; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028936; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029296; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000117102; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0074568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0074647; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0074550; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0074587; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0074219; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0075055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0074768; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0074170; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0074309; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0074212; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0074369; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0074216; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0075288; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0074220; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0073344; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3005
FT                   /organism="Mus musculus"
FT                   /strain="CD1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..3005
FT                   /gene="Fz10"
FT   CDS             113..1861
FT                   /codon_start=1
FT                   /gene="Fz10"
FT                   /product="frizzled 10"
FT                   /note="receptor"
FT                   /db_xref="GOA:Q8BKG4"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026549"
FT                   /db_xref="MGI:MGI:2136761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BKG4"
FT                   /protein_id="AAR92468.1"
FT                   /translation="MQHPGPRLWLVLQVMIGSCTAISSMDLERPGDGKCQPVEIPMCKD
FT                   IGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPI
FT                   PACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGS
FT                   GMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSR
FT                   DDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIR
FT                   LFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAG
FT                   KKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFV
FT                   LVPLACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATC
FT                   VIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGI
FT                   TSGVWVWTSKTLQSWQHVCSRGLKRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPA
FT                   QPSACV"
XX
SQ   Sequence 3005 BP; 682 A; 797 C; 839 G; 687 T; 0 other;
     tggatgggca tgcgcggggg cccgagccgg ggcgcggagc cgcgggcagc agcaacagcc        60
     cgtgcccggg agcggcggcc ctgagcggcg ctgggacatt gagggcgcca ccatgcaaca       120
     cccgggcccg cgcctgtggc tggtgctgca ggtgatgata ggctcgtgca cggccatcag       180
     ctccatggac ttagagcgcc ctggagacgg caagtgccag ccggtggaga ttcccatgtg       240
     caaggacatc ggctacaaca ccacccgcat gcccaacctg atgggtcacg agaaccagcg       300
     cgaggcggcc atccaactgc acgagttcgc gccgctcgtg gagtacggct gccacagcca       360
     ccttcgcttc ttcctgtgtt cgctgtacgc gcccatgtgc accgagcagg tctccacacc       420
     catccctgct tgccgggtca tgtgcgagca ggcccggctc aagtgctcgc cgatcatgga       480
     gcagttcaaa ttcaggtggc cggactccct ggattgcagc aagctcccca acaagaacga       540
     ccccaactac ctgtgcatgg aggcacccaa caacggctcg gatgagccca gccggggctc       600
     tggcatgttt cctccgctct tcaggcccca gaggccccac agcgcgcagg agcacccact       660
     aaaggacggg ggtccggggc gcgcaggttg tgacaaccca ggcaagttcc accatgtgga       720
     gaagagcgaa tcttgcgcac cgctttgcac tccgggggtg gatgtgtatt ggagccgcga       780
     cgacaagcgc ttcgctgtgg tctggctggc catctggtcc gtgctgtgct tcttctccag       840
     cgccttcacc gtgctcacct tcctcatcga cccatcgcgc ttcaggtacc ccgaacgtcc       900
     tatcatcttc ctctccatgt gctactgcgt ttattcggtg ggctatatca tccgcctctt       960
     cgcgggcgcg gagagcatcg cttgtgaccg ggacagtggg cagctgtatg ttatccagga      1020
     aggactggag agcacgggct gtaccttagt cttcttggta ctttactact tcggcatggc      1080
     cagctcttta tggtgggtgg tcctcaccct cacttggttc ctggctgctg gaaagaagtg      1140
     gggccatgag gccattgaag ccaacagcag ctactttcac ctggcagctt gggccatccc      1200
     ggctgtgaag actatcttga tcttggtgat gcgcagggtg gcaggggatg agctcactgg      1260
     tgtgtgttat gtgggcagca tggatgtcaa tgctctgacc ggcttcgtgc tggtcccgct      1320
     ggcttgctac ctagtcatcg gcacttcctt catcctgtcc ggctttgtgg ctttattcca      1380
     catccggagg gtgatgaaaa cgggtgggga gaacacggac aagctggaga agctcatggt      1440
     acgcataggg gtcttctccc tcctctacac tgtgccggcc acctgtgtga ttgcctgcta      1500
     tttttatgaa cgcctcaaca tggactactg gaagatgctg gccacccagc acaagtgtaa      1560
     gatgaacaat cagaccaaga cacctgactg cctgatgacc acctccatcc ctgccgtgga      1620
     ggtcttcatg gtcaaagtgt ccatgctgct ggtggtgggc atcaccagtg gggtgtgggt      1680
     ctggacttcc aagaccctgc agtcctggca acacgtatgc agccgggggc taaagagaaa      1740
     aagccggagg aaaccagcca gtgtggtcac cagtgcaggg atctacaaaa aagcccagca      1800
     cccccaaaaa cctcaccttg ggaagtatga actgcccgcc cagccttcag cctgcgtgtg      1860
     aaggcagagc tggctgcaag aacaggacat tcggagccca aatgggcagc ttttcttggt      1920
     tggctggttg ttggtaaatc aaagtaaaaa gaatatgtat atatatatac atgtatgtgt      1980
     atgcatgtgc atatatatgc atatatttac acatacatga agtctacctt gaggttcaga      2040
     acagctgaat gtaaagggtt ctgttcagtt tgttgcctcc ctgaagggtc gctcattaag      2100
     gagggagcct cttgtgtaac taatttgtgg taaagtagtt gattcaaccg ccctccagaa      2160
     aacttttgtt taggcctcaa gcacacagct gtgtattcag aaggctttgc tgcctgtgca      2220
     taaacttgag gctggagagc tcctttgtaa gctaaagagc tttcctgggg gggggggggg      2280
     gcagccagtg agccacccaa gggcctgctc tccctccctc actcccccag ctaggctgct      2340
     gtatgggtgg gagggaaggt gaggaggaga ggggataaaa gaggtgacac cccccccagc      2400
     ccaaggtctg cctgcagatc ccttaaaaga gagtcacttc cccagccttc atagccatgt      2460
     ttctcccaac acagagccca cgctaccctc tcaccccact gcagatctaa cactggagaa      2520
     ttcaaatggt gtgcaatact tttttttttt tttttttaca ttttccccct ctccctagca      2580
     aaacaaatga gagagagaaa aagtattttg ttgtaaataa aaggcaagaa aagaaatcat      2640
     ctaacaaaag aatttagagg ctcaagcctc agggttgggg gttggggggg cgccttcagc      2700
     ctgatacatt ttgtggcttt ttaatggaaa ccaagccagt gtgttctaca cactgggact      2760
     gatttgtgga gaggaagggg gaggggggga agccagtgga gagcaccaga gggcttattg      2820
     actctctgaa ttgttaaaca aatgatttcc atgagtggtc ttgaagcact tgggaagaca      2880
     aactttgtct ccagccaggg agggccatgc ctgcctctgt atatctgtaa tataggatat      2940
     ttttcatgct ccactatttt attaaaaata aaagacattc tttagtttaa aaaaaaaaaa      3000
     aaaaa                                                                  3005
//