spacer

EBI Dbfetch

ID   AY494857; SV 1; linear; mRNA; STD; MUS; 2885 BP.
XX
AC   AY494857;
XX
DT   24-SEP-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus putative protein-O-mannosyltransferase 1 (Pomt1) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2885
RX   DOI; 10.1073/pnas.0405899101.
RX   PUBMED; 15383666.
RA   Willer T., Prados B., Falcon-Perez J.M., Renner-Muller I., Przemeck G.K.,
RA   Lommel M., Coloma A., Valero M.C., De Angelis M.H., Tanner W., Wolf E.,
RA   Strahl S., Cruces J.;
RT   "Targeted disruption of the Walker-Warburg syndrome gene Pomt1 in mouse
RT   results in embryonic lethality";
RL   Proc. Natl. Acad. Sci. U.S.A. 101(39):14126-14131(2004).
XX
RN   [2]
RP   1-2885
RA   Willer T., Prados B., Falcon J.M., Renner-Mueller I., Coloma A., Valero C.,
RA   Przemeck G., Hrabe de Angelis M., Wolf E., Tanner W., Strahl S., Cruces J.;
RT   ;
RL   Submitted (03-DEC-2003) to the INSDC.
RL   Departamento de Bioquimica, Universidad Autonoma de Madrid, Arzobispo
RL   Morcillo, 4, Madrid 28029, Spain
XX
DR   MD5; 6afc756e5d733ed9f0be2aaece4b4a9b.
DR   Ensembl-Gn; ENSMUSG00000039254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036473; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2885
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="2B"
FT                   /strain="Swiss Webster/NIH"
FT                   /mol_type="mRNA"
FT                   /dev_stage="17-day embryo"
FT                   /db_xref="taxon:10090"
FT   gene            1..2885
FT                   /gene="Pomt1"
FT   CDS             84..2324
FT                   /codon_start=1
FT                   /gene="Pomt1"
FT                   /product="putative protein-O-mannosyltransferase 1"
FT                   /function="transfers glycosyl groups"
FT                   /note="integral membrane protein; endoplasmic reticulum
FT                   protein"
FT                   /db_xref="GOA:Q8R2R1"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="MGI:MGI:2138994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R2R1"
FT                   /protein_id="AAS76201.1"
FT                   /translation="MGSHSTGLEETLGVLPSWLFCKMLRFLKRPLVVTVDINLNLVALT
FT                   GLGLLTRLWQLSYPRAVVFDEVYYGQYISFYMKRIFFLDDSGPPFGHMLLALGGWLGGF
FT                   DGNFLWNRIGAEYSSNVPIWSLRLLPALAGALSVPMAYQIVLELHFSHGAAIGAALLML
FT                   IENALITQSRLMLLESILIFFNLLAVLSYLKFFNSQTHSPFSVHWWLWLLLTGVSCSCA
FT                   VGIKYMGIFTYLLVLGIAAVHAWNLIGDQTLSNMRVLSHLLARIVALLVVPVFLYLLFF
FT                   YVHLMLLYRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLKSVSGKPLPCW
FT                   LHSHKNTYPMIYENGRGSSHQQQVTCYPFKDINNWWIVKDPGRHQLVVNNPPRPVRHGD
FT                   IVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWKLDIVNRESNRDTW
FT                   KTILSEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKLSPGYHESMVWNVEEHRYGK
FT                   SHEQKERELELHSPTQLDISRNLSFMARFSELQWKMLTLKNEDLEHQYSSTPLEWLTLD
FT                   TNIAYWLHPRTSAQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRRRSICDLPEDAWSR
FT                   WVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPIVLQHASDHLCRSQLQ
FT                   RNVFSALVVAWYSSACHVSNMLRPLTYGDTSLSPGELRALRWKDSWDILIRK"
XX
SQ   Sequence 2885 BP; 634 A; 845 C; 739 G; 667 T; 0 other;
     cgatccgtgg ccgctgcaga gtaatcgagc ggcctcgccc ccaacggtcg atcctgcctg        60
     gcggttcgca ggcctggctc cacatgggga gccactctac gggactcgaa gaaacgctcg       120
     gagtcctccc gagctggctt ttctgcaaaa tgttaagatt tttgaaacgg cctctagtgg       180
     tgactgttga catcaatttg aacttggtag ctctgactgg cctgggacta cttacccgac       240
     tatggcaact ctcctaccct cgggctgtgg ttttcgatga agtatattat gggcagtaca       300
     tttccttcta catgaagcgc atcttctttc tggatgacag tgggccacca tttggccaca       360
     tgctactggc cttaggaggt tggttagggg gattcgatgg taactttctg tggaaccgaa       420
     ttggagcaga gtacagtagc aatgtgccta tatggtcctt acgcctgctg ccagcgcttg       480
     ccggggccct gtcagtgccc atggcctacc agatagtgct agagctccac ttttcccacg       540
     gtgctgccat tggagccgcc ctgctgatgc tcattgagaa cgccctgatc actcagtcca       600
     ggctcatgct gttggagtcc atactgatat tttttaacct gttggctgtg ttgtcctatc       660
     tgaagttctt caactcccag acacacagcc ctttctcagt gcactggtgg ctgtggctac       720
     tgctgaccgg ggtctcttgt tcctgtgcag ttgggatcaa atacatgggg attttcacct       780
     acctgcttgt gctcggcatt gcagctgtcc acgcgtggaa tctgatcgga gaccagacct       840
     tgtcaaatat gcgcgtgctc agtcacttgc tcgccagaat cgtggctctg ctggtcgtcc       900
     cagtcttcct gtacttactc ttcttctatg tccacctgat gctgctctac cgctctgggc       960
     cccatgacca aatcatgtcc agtgccttcc aggccagctt ggagggaggg cttgcccgca      1020
     tcacccaagg ccagcccctg gaggtggcct ttggttccca ggtcactctg aagagcgtct      1080
     ctggcaaacc cttgccctgc tggcttcatt cgcacaagaa cacctatccc atgatatatg      1140
     agaatggccg tggcagctcc caccagcaac aggtgacctg ttatcccttc aaagacatca      1200
     ataactggtg gatcgtcaag gatcctgggc gacaccagct ggtggtaaac aaccctcccc      1260
     ggcctgtaag acatggagac attgtacagc tcgttcacgg catgaccacc cgcctcctta      1320
     acacgcacga tgtcgcagcc ccactgagcc cccattctca agaagtctcc tgctacattg      1380
     actataacat ctccatgcct gcccagaacc tctggaaact ggacattgtg aacagagagt      1440
     ccaaccggga tacctggaag actatcttgt cggaagtgcg ctttgtacat gtgaacacat      1500
     ccgccatctt gaagctgagc ggggctcacc tccctgactg ggggttccgg cagttggagg      1560
     tagttgggga gaagttgtca ccgggctacc acgagagcat ggtgtggaat gtggaagaac      1620
     accggtatgg caaaagccat gagcagaagg agagggagct ggagctccac tcgcccactc      1680
     agctcgatat cagcaggaac ctcagcttca tggccagatt ctcagagtta cagtggaaga      1740
     tgctgacgct gaagaatgag gacttggaac accagtacag ctccaccccg ctggagtggc      1800
     tcacgctgga caccaacatc gcctattggc tacatcccag gaccagtgct cagatccact      1860
     tgcttgggaa cattgtgatc tggacttcag ccagccttgc cacagtggtc tacactctac      1920
     tcttcttctg gtacctgctc cgccggcgaa ggagcatctg tgacctccct gaggatgcct      1980
     ggtcccgctg ggtgctggct ggagccctgt gtactggcgg ctgggcactc aactacctgc      2040
     ccttcttcct gatggagagg gtgctcttcc tctaccacta cttgccggca ctcaccttcc      2100
     agatcctgct gctcccgatt gtcctgcagc acgccagcga ccatctgtgc aggtcccagc      2160
     tgcagaggaa tgtcttcagt gccctggttg tagcatggta ttcctccgca tgccatgtgt      2220
     ccaacatgct acgcccacta acctatgggg acacgtcact ctcaccaggc gagctccggg      2280
     cccttcgctg gaaagacagc tgggatattc tgatccgaaa gtaatagaga acaagaacac      2340
     agaagacaag cacacaggac aaagcctcaa agatgtgttt gtctcccacc aacaggagcc      2400
     tcagcaggca ggactgccag ggtccaggag gaactccagg gactaattcc aatttcacct      2460
     caagagccct gtccactggt tccttgtttg aagcaattga tttctcttca cacagtgaag      2520
     aatgtgccca gccacagcgt tacccatgag gcccaactct gacccagcca gagtttgagc      2580
     tgccagtgta ggaaccacca aggcaggagg ggcacccagc cagggaagga gtggggggga      2640
     ctcaggacga gctgcgggcc tactataggg ccttagccct gtcatttatg gggcccacag      2700
     tgccacacct cattgggcac aggcacagcc accctctgta aaccctgaaa gctgccagcc      2760
     atccacagac tcctgagcca actctaaaga gtcctgggag actgcagcca cctaactgcc      2820
     acggccaagg tgtcgtccat tcacttcctt acctttaatg taaataaaac aggacaaatt      2880
     gttaa                                                                  2885
//


spacer
spacer