spacer

EBI Dbfetch

ID   AY461712; SV 1; linear; mRNA; STD; HUM; 3859 BP.
XX
AC   AY461712;
XX
DT   02-DEC-2003 (Rel. 78, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens putative N-ATPase mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3859
RA   Liu J.-P., Li H.;
RT   "Homo sapiens putative ATPase (N-ATPase) mRNA";
RL   Unpublished.
XX
RN   [2]
RP   1-3859
RA   Liu J.-P., Li H.;
RT   ;
RL   Submitted (08-NOV-2003) to the INSDC.
RL   Pathology and Immunology, Monash University, AMREP, Commercial Road,
RL   Prahran, Vic 3181, Australia
XX
DR   MD5; 6156d8e2b39569d354a2eb9ce04bfe57.
DR   Ensembl-Gn; ENSG00000159363; homo_sapiens.
DR   Ensembl-Tr; ENST00000326735; homo_sapiens.
DR   Ensembl-Tr; ENST00000341676; homo_sapiens.
DR   Ensembl-Tr; ENST00000452699; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3859
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             49..3576
FT                   /codon_start=1
FT                   /product="putative N-ATPase"
FT                   /db_xref="GOA:Q9NQ11"
FT                   /db_xref="H-InvDB:HIT000254808.14"
FT                   /db_xref="HGNC:HGNC:30213"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006544"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9NQ11"
FT                   /protein_id="AAR23423.1"
FT                   /translation="MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPW
FT                   RVIGYHVVVWMMAGIPLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFT
FT                   VQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLF
FT                   QGQRYIWIETQQAFYQVSLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKS
FT                   YPQLLVDEALNPYYGFQAFSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLR
FT                   DMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSL
FT                   TGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAK
FT                   GGLVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALD
FT                   LVTVVVPPALPAAMTVCTLYAQSRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDG
FT                   LDVMGVVPLKGQAFLPLVPEPRRLPVGPLLRALATCHALSRLQDTPVGDPMDLKMVEST
FT                   GWVLEEEPAADSAFGTQVLAVMRPPLWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVV
FT                   VAWPGATQPEAYVKGSPELVAGLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVP
FT                   SLEAAQQLTRDTVEGDLSLLGLLVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAV
FT                   TVARGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASYTVEPD
FT                   PRSRHLALSGPTFGIIVKHFPKLLPKVLVQGTVFARMAPEQKTELVCELQKLQYCVGMC
FT                   GDGANDCGALKAADVGISLSQAEASVVSPFTSSMASIECVPMVIREGRCSLDTSFSVFK
FT                   YMALYSLTQFISVLILYTINTNLGDLQFLAIDLVITTTVAVLMSRTGPALVLGRVRPPG
FT                   ALLSVPVLSSLLLQMVLVTGVQLGGYFLTLAQPWFVPLNRTVAAPDNLPNYENTVVFSL
FT                   SSFQYLILAAAVSKGAPFRRPLYTNVPFLVALALLSSVLVGLVLVPGLLQGPLALRNIT
FT                   DTGFKLLLLGLVTLNFVGAFMLESVLDQCLPACLRRLRPKRASKKRFKQLERELAEQPW
FT                   PPLPAGPLR"
XX
SQ   Sequence 3859 BP; 703 A; 1277 C; 1159 G; 720 T; 0 other;
     gcccgagggc cgcagcgccg gggccggcga tgagcgcgag gagccggcat gagcgcagac        60
     agcagccctc tcgtgggcag cacgcccacc ggttatggga ccctgacgat agggacatca       120
     atagatcccc tcagctcctc agtttcatcc gtgaggctca gcggctactg tggcagtcca       180
     tggagggtca tcggctatca cgtcgtggtc tggatgatgg ctgggatccc tttgctgctc       240
     ttccgttgga agcccctgtg gggggtgcgg ctgcggctcc ggccctgcaa cctggcccac       300
     gccgaaacac tcgttatcga aataagagac aaagaggata gttcctggca gctcttcact       360
     gtccaggtgc agactgaggc catcggcgag ggcagcctgg agccgtcccc acagtcccag       420
     gcagaggatg gccggagcca ggcggcagtt ggggcggtac cagagggtgc ctggaaggat       480
     acggcccagc tccacaagag cgaggaggcg aagcgggtgc tgcggtatta cctcttccag       540
     ggccagcgct atatctggat cgagacccag caagccttct accaggtcag cctcctggac       600
     catggccgct cttgtgacga cgtccaccgc tcccgccatg gcctcagcct ccaggaccaa       660
     atggtgagga aggccattta cggccccaac gtgatcagca taccggtcaa gtcctacccc       720
     cagctgctgg tggacgaggc actgaacccc tactatgggt tccaggcctt cagcatcgcg       780
     ctgtggctgg ctgaccacta ctactggtac gccctgtgca tcttcctcat ttcctccatc       840
     tccatctgcc tgtcgctgta caagaccaga aagcaaagcc agactctaag ggacatggtc       900
     aagttgtcca tgcgggtgtg cgtgtgccgg ccagggggag aggaagagtg ggtggactcc       960
     agtgagctag tgcccggaga ctgcctggtg ctgccccagg agggtgggct gatgccctgt      1020
     gatgccgccc tggtggccgg cgagtgcatg gtgaatgaga gctctctgac aggagagagc      1080
     attccagtgc tgaagacggc actgccggag gggctggggc cctactgtgc agagacacac      1140
     cggcggcaca cactcttctg cgggaccctc atcttgcagg cccgggccta tgtgggaccg      1200
     cacgtcctgg cagtggtgac ccgcacaggg ttctgcacgg caaaaggggg cctggtgagc      1260
     tccatcttgc acccccggcc catcaacttc aagttctata aacacagcat gaagtttgtg      1320
     gctgccctct ctgtcctggc tctcctcggc accatctaca gcatcttcat cctctaccga      1380
     aaccgggtgc ctctgaatga gattgtaatc cgggctctcg acctggtgac cgtggtggtg      1440
     ccacctgccc tgcctgctgc catgactgtg tgcacgctct acgcccagag ccgactgcgg      1500
     agacagggca ttttctgcat ccacccactg cgcatcaacc tggggggcaa gctgcagctg      1560
     gtgtgtttcg acaagacggg caccctcact gaggacggct tagacgtgat gggggtggtg      1620
     cccctgaagg ggcaggcatt cctgcccctg gtcccagagc ctcgccgcct gcctgtgggg      1680
     cccctgctcc gagcactggc cacctgccat gccctcagcc ggctccagga cacccccgtg      1740
     ggcgacccca tggacttgaa gatggtggag tctactggct gggtcctgga ggaagagccg      1800
     gctgcagact cagcatttgg gacccaggtc ttggcagtga tgagacctcc actttgggag      1860
     ccccagctgc aggcaatgga ggagcccccg gtgccagtca gcgtcctcca ccgcttcccc      1920
     ttctcttcgg ctctgcagcg catgagtgtg gtggtggcgt ggccaggggc cactcagccc      1980
     gaggcctacg tcaaaggctc cccggagctg gtggcagggc tctgcaaccc cgagacagtg      2040
     cccaccgact tcgcccagat gctgcagagc tatacagctg ctggctaccg tgtcgtggcc      2100
     ctggccagca agccactgcc cactgtgccc agcctggagg cagcccagca actgacgagg      2160
     gacactgtgg aaggagacct gagcctcctg gggctgctgg tcatgaggaa cctactgaag      2220
     ccgcagacaa cgccagttat ccaggctctg cgaaggaccc gcatccgcgc cgtcatggtg      2280
     acaggggaca acctgcagac agcggtgact gtggcccggg gctgtggcat ggtggccccc      2340
     caggagcatc tgatcatcgt ccacgccacc caccctgagc ggggtcagcc tgcctctctc      2400
     gagttcctgc cgatggagtc ccccacagcc gtgaatggcg ttaaggatcc tgaccaggct      2460
     gcaagctaca ccgtggagcc agacccccga tccaggcacc tggccctcag cgggcccacc      2520
     tttggtatca ttgtgaagca cttccccaag ctgctgccca aggtcctggt ccagggcact      2580
     gtctttgccc gcatggcccc tgagcagaag acagagctgg tgtgcgagct acagaagctt      2640
     cagtactgcg tgggcatgtg cggagacggt gccaatgact gtggggccct gaaggcggct      2700
     gatgtcggca tctcgctgtc ccaggcagaa gcctcagtgg tctcaccctt cacctcgagc      2760
     atggccagta ttgagtgcgt gcccatggtc atcagggagg ggcgctgttc tcttgacact      2820
     tcgttcagcg tcttcaagta catggctctg tacagcctga cccagttcat ctccgtcctg      2880
     atcctctaca cgatcaacac caacctgggt gacctgcagt tcctggccat cgacctggtc      2940
     atcaccacca cagtggcagt gctcatgagc cgcacggggc cagcgctggt cctgggacgg      3000
     gtacggccac cgggggcgct gctcagcgtg cccgtgctca gcagcctgct gctgcagatg      3060
     gtcctggtga ccggcgtgca gctagggggc tacttcctga ccctggccca gccatggttc      3120
     gtgcctctga acaggacagt ggccgcacca gacaacctgc ccaactacga gaacaccgtg      3180
     gtcttctctc tgtccagctt ccagtacctc atcctggctg cagctgtgtc caagggggcg      3240
     cccttccgcc ggccgctcta caccaatgtg cccttcctgg tggccctggc gctcctgagc      3300
     tccgtcctgg tgggccttgt cctggtcccc ggcctcctgc aggggccgct ggcgctgagg      3360
     aacatcactg acaccggctt caagctgctg ctgctgggtc tggtcaccct caacttcgtg      3420
     ggggccttca tgctggagag cgtgctagac cagtgcctcc ccgcctgcct gcgccgcctc      3480
     cggcccaagc gggcctccaa gaagcgcttc aagcagctgg aacgagagct ggccgagcag      3540
     ccctggccac cgctgcccgc cggccccctg aggtagtgca ggcccacggg caccccagac      3600
     actggaactc cctgcctctg agccaccaac tggacccctc tccagcaaca ccaccgccac      3660
     cacctcccac atccctgagg ttggcgactg tctacactcc tcccccgaga ccacccccac      3720
     cctggggaag cgttgactac tgtcccctac cttggaccat cccgcgtagg ggtggcagcc      3780
     cccagctccc ctcagtgctg ctgtcagtgt agcaaataaa gtcatgatat tttcctggca      3840
     aaaaaaaaaa aaaaaaaaa                                                   3859
//


spacer
spacer