spacer

EBI Dbfetch

ID   AY450671; SV 1; linear; mRNA; STD; MUS; 282 BP.
XX
AC   AY450671;
XX
DT   03-DEC-2003 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus 5-hydroxytryptamine receptor 7c isoform mRNA, partial cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-282
RX   PUBMED; 16131615.
RA   Amireault P., Dube F.;
RT   "Intracellular cAMP and calcium signaling by serotonin in mouse
RT   cumulus-oocyte complexes";
RL   Mol. Pharmacol. 68(6):1678-1687(2005).
XX
RN   [2]
RP   1-282
RA   Amireault P., Dube F.;
RT   ;
RL   Submitted (27-OCT-2003) to the INSDC.
RL   Obstetrics-Gynecology, CHUM Research Center, Saint-Luc Hospital, 264 Rene
RL   Levesque Est, Montreal, Qc H2X 1P1, Canada
XX
DR   MD5; caa02910eedbba40407fa2470d58bfb0.
DR   Ensembl-Gn; ENSMUSG00000024798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099505; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..282
FT                   /organism="Mus musculus"
FT                   /strain="B6C3F1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..209
FT                   /codon_start=3
FT                   /product="5-hydroxytryptamine receptor 7c isoform"
FT                   /note="5-HT7c receptor; G protein coupled receptor;
FT                   alternatively spliced"
FT                   /db_xref="GOA:Q6ST19"
FT                   /db_xref="InterPro:IPR001069"
FT                   /db_xref="MGI:MGI:99841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ST19"
FT                   /protein_id="AAR24086.1"
FT                   /translation="QCQYRNINRKLSAAGMHEALKLAERPERSEFVLMTGASGVQKALE
FT                   NLPWGNGVNTGIKAVNSVALTKL"
FT   misc_feature    101..197
FT                   /note="alternatively spliced intron sequence, resulting in
FT                   alternative C-terminus"
XX
SQ   Sequence 282 BP; 86 A; 58 C; 84 G; 54 T; 0 other;
     tccagtgcca gtaccggaat atcaaccgga agctctctgc tgcaggcatg cacgaagccc        60
     tgaaacttgc tgagaggcct gagagaagcg agtttgtgct catgactgga gcctcaggag       120
     tccagaaggc actggagaat ttaccttggg gtaacggagt gaatacaggg ataaaagctg       180
     tgaattctgt tgcactgaca aaactgtgac cactgtggga aaaaaggtca tgatacatga       240
     tccagagcgg aaccctggag aagaagtaat gcagaacagg gg                          282
//


spacer
spacer