Dbfetch

ID   AY450670; SV 1; linear; mRNA; STD; MUS; 190 BP.
XX
AC   AY450670;
XX
DT   03-DEC-2003 (Rel. 78, Created)
DT   19-AUG-2006 (Rel. 88, Last updated, Version 2)
XX
DE   Mus musculus 5-hydroxytryptamine receptor 7b isoform mRNA, partial cds,
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-190
RX   PUBMED; 16131615.
RA   Amireault P., Dube F.;
RT   "Intracellular cAMP and calcium signaling by serotonin in mouse
RT   cumulus-oocyte complexes";
RL   Mol. Pharmacol. 68(6):1678-1687(2005).
XX
RN   [2]
RP   1-190
RA   Amireault P., Dube F.;
RT   ;
RL   Submitted (27-OCT-2003) to the INSDC.
RL   Obstetrics-Gynecology, CHUM Research Center, Saint-Luc Hospital, 264 Rene
RL   Levesque Est, Montreal, Qc H2X 1P1, Canada
XX
DR   MD5; 83744a986d83e5e5933f32d84518edcb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..190
FT                   /organism="Mus musculus"
FT                   /strain="B6C3F1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..104
FT                   /codon_start=3
FT                   /product="5-hydroxytryptamine receptor 7b isoform"
FT                   /note="5-HT7b receptor; G protein coupled receptor;
FT                   alternatively spliced"
FT                   /db_xref="GOA:Q6ST20"
FT                   /db_xref="InterPro:IPR001069"
FT                   /db_xref="MGI:MGI:99841"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ST20"
FT                   /protein_id="AAR24085.1"
FT                   /translation="QCQYRNINRKLSAAGMHEALKLAERPERSEFVL"
FT   misc_feature    101..105
FT                   /note="alternatively spliced intron sequence, contains 5
FT                   nucleotide insertion including a stop codon"
XX
SQ   Sequence 190 BP; 60 A; 41 C; 56 G; 33 T; 0 other;
     tccagtgcca gtaccggaat atcaaccgga agctctctgc tgcaggcatg cacgaagccc        60
     tgaaacttgc tgagaggcct gagagaagcg agtttgtgct gtaagacaaa actgtgacca       120
     ctgtgggaaa aaaggtcatg atacatgatc cagagcggaa ccctggagaa gaagtaatgc       180
     agaacagggg                                                              190
//