spacer

EBI Dbfetch

ID   AY428162; SV 1; linear; mRNA; STD; MUS; 441 BP.
XX
AC   AY428162;
XX
DT   30-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus interleukin 21 (Il21) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-441
RA   Guobing C., Jun D., Junsong C., Fenshu Z.;
RT   "Mouse interleukin 21 can improve the anti-tumor effect of LAK cells";
RL   Unpublished.
XX
RN   [2]
RP   1-441
RA   Guobing C., Jun D.;
RT   ;
RL   Submitted (06-OCT-2003) to the INSDC.
RL   Department of Microbiology and Immunology, Medical College, Southeast
RL   University, 87 Dingjiaqiao, Nanjing, Jiangshu 210009, China
XX
DR   MD5; a72d30c1d3b664a37ea4d7dc1995c341.
DR   Ensembl-Gn; ENSMUSG00000027718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029273; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..441
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /cell_type="splenocytes"
FT                   /db_xref="taxon:10090"
FT   gene            1..441
FT                   /gene="Il21"
FT   CDS             1..441
FT                   /codon_start=1
FT                   /gene="Il21"
FT                   /product="interleukin 21"
FT                   /note="mIL21"
FT                   /db_xref="GOA:Q9ES17"
FT                   /db_xref="InterPro:IPR003443"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:1890474"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ES17"
FT                   /protein_id="AAR06254.1"
FT                   /translation="MERTLVCLVVIFLGTVAHKSSPQGPDRLLIRLRHLIDIVEQLKIY
FT                   ENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARR
FT                   GGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS"
XX
SQ   Sequence 441 BP; 134 A; 107 C; 99 G; 101 T; 0 other;
     atggagagga cccttgtctg tctggtagtc atcttcttgg ggacagtggc ccataaatca        60
     agcccccaag ggccagatcg cctcctgatt agacttcgtc accttattga cattgttgaa       120
     cagctgaaaa tctatgaaaa tgacttggat cctgaacttc tatcagctcc acaagatgta       180
     aaggggcact gtgagcatgc agcttttgcc tgttttcaga aggccaaact caagccatca       240
     aaccctggaa acaataagac attcatcatc gacctcgtgg cccagctgag gaggaggctg       300
     cctgccagga ggggaggaaa gaaacagaag cacatagcta aatgcccttc ctgtgattcg       360
     tatgagaaaa gaacacccaa agaattccta gaaagactaa aatggctcct tcaaaagatg       420
     attcatcagc atctctccta g                                                 441
//


spacer
spacer