spacer

EBI Dbfetch

ID   AY424291; SV 1; linear; mRNA; STD; MUS; 3969 BP.
XX
AC   AY424291;
XX
DT   03-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus progestin and adipoQ receptor family member II (Paqr2) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3969
RA   Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J., Emtage P., Funk W.;
RT   "PAQR proteins: a novel membrane receptor family defined by an ancient
RT   7-transmembrane pass motif";
RL   Unpublished.
XX
RN   [2]
RP   1-3969
RA   Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J., Emtage P., Funk W.;
RT   ;
RL   Submitted (29-SEP-2003) to the INSDC.
RL   Biological Research, Nuvelo, 675 Almanor Ave, Sunnyvale, CA 94085, USA
XX
DR   MD5; 35547f0092e72546207c3b88f8f8fd13.
DR   Ensembl-Gn; ENSMUSG00000030168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169744; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3969
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..3969
FT                   /gene="Paqr2"
FT   CDS             153..1313
FT                   /codon_start=1
FT                   /gene="Paqr2"
FT                   /product="progestin and adipoQ receptor family member II"
FT                   /note="AdipoR2"
FT                   /db_xref="GOA:Q53YY3"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:93830"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YY3"
FT                   /protein_id="AAR08379.1"
FT                   /translation="MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPS
FT                   LETPVCSSYYENSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWR
FT                   VIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLG
FT                   IFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSG
FT                   IALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGV
FT                   FVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGK
FT                   CDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCTEEDAL"
XX
SQ   Sequence 3969 BP; 964 A; 934 C; 998 G; 1073 T; 0 other;
     cacaagaatc cgtggagctc agcagtaccc tcagactctg gtctacaact ctgacaggat        60
     ttggggtcaa cttaccatcc cttaaaaatc cattctccca agaagaaggg acagaaagaa       120
     agaccacttt gtaagaaagg ctttggtatc ccatgaacga gccagccaaa caccgattgg       180
     ggtgcaccag gactccagag ccagatatac ggctcagaaa agggcaccaa cttgatgata       240
     caaggggaag taataatgac aactaccaag gagatttgga gcccagctta gagacacctg       300
     tttgttcttc ctattatgaa aatagcccgg aggagcccga gtgtcatgat gacaattccc       360
     aggaagatga agggtttatg ggcatgtccc cgctcctaca ggcccatcat gctatggaac       420
     gaatggaaga gtttgtttgt aaggtgtggg aaggccgatg gcgagtgatc cctcacgatg       480
     tgctaccgga ttggcttaag gataatgact tccttctcca tggacaccgg cctcctatgc       540
     cttcctttcg ggcctgtttt aagagcattt ttagaataca cacagagacg ggcaacattt       600
     ggacacatct cctaggttgt gtattcttcc tgtgcctggg gatcttttat atgtttcgcc       660
     caaatatatc ttttgtggcc cctctgcaag agaaagtggt ctttggcttg ttcttcttgg       720
     gagccattct ctgcctttcc ttttcatggc tcttccacac ggtgtactgc cactcagaag       780
     gggtctcccg actcttctct aaattggatt actctggtat tgctcttctg atcatgggaa       840
     gttttgttcc ttggctttat tattctttct actgtaaccc acaaccttgc ttcatctacc       900
     tgattgtcat ctgtgtgctg ggcattgcag ccattatcgt ctctcagtgg gacatgtttg       960
     ccacccctca gtatcggggg gtcagagcag gagtgttcgt gggcttaggc ctgagtggaa      1020
     tcatccctac cttgcattat gtcatctcag aagggttcct gaaggctgcc accatagggc      1080
     agataggctg gctaatgctt atggctagcc tctatatcac cggagctgcc ctctatgcgg      1140
     cccgtatccc tgagcgcttc tttcctggca aatgtgacat ctggtttcac tctcatcagc      1200
     tcttccacat ctttgtggtt gctggtgcct ttgttcactt ccacggagtc tcaaacctgc      1260
     aggaatttcg tttcatgatt ggcgggggct gcactgaaga ggatgcactg tgatactctc      1320
     caggaaccag ggactctgac cctgagccag gcctgcaggt cctgcaggcc ttcttactgg      1380
     ctgtcggtgc cagtgccaga gaagccccaa aacttggaca gcctcatggg ccttgtgttg      1440
     gcccaagggc tccatggggt acaagactaa gaagagaaaa acaaaaataa atcatacctc      1500
     aaaggatgga atgcatcgat taggagagaa ggagaaatgg ctcatcccct ggcttcctct      1560
     tgggatctac cgattgaaag caactctgca agaccctcgc ctgacaggct ggcttctgat      1620
     gtgatcgtat ttatttgtag aagatgggga aacagtttag ttggtggtct ttcttctccc      1680
     ttccttgctc cttgcagcag taacatgtat gagtaccatg caccaactga tcgtgccatt      1740
     ggagctcctt aaacagtaat cacaaccaag ctaggggaac atttgtatcc aataaagggg      1800
     tgggagtgcg gttttaggca ctcctttggg agaacaaaga aattaatgta aataagattt      1860
     ctaatttact gtttaaataa gaatttatat aaacatttaa gacatagggg cagggaggga      1920
     gggagacttt ttttaaaaag aatgaaacat gcaagtacca cacactgttt caattttgca      1980
     caagtgatgg gaggaggatg gagtggtagc cccagaatgc acgatgtctt ggtgcaccaa      2040
     ggtgccttcc ctaggccgat aacacttgga ccctgctggg gcagagtgga cagccccagc      2100
     ccaggaactt cctggccact ctcaagactg agagcctttg ggcattcaga gggggaggga      2160
     tgtggaagtc gtgtgtgctt ttcaatggaa gcagcacagg ttgtcatagt ggctctagag      2220
     aaagtgtcat ttgggagact gttatgtagg ctagtgatga cccttttgaa gagtgaagcc      2280
     acctggttct actgtagatg tagtagagac ttgatgaagg ggaggaggac ctgggggcat      2340
     cagcatagga ctggtctgct tctccctggt gtctcgtttg accaggtggt agttcttatc      2400
     tgaatagagg tatggccatt ttccagaccc tctctgtgga gctctgagcc attctgcaaa      2460
     ttttgctcta ttgagaatca ctgccctaac tgtccttcct cctggaaatc aaaaactgcc      2520
     cccccccccc cagcatcaaa gctccttcgt ggagccggcc actagtgaga ttctgatgag      2580
     catgggtccc acctgaagtc atgcaggcag gtgtggagga ccatcccttg gactaggaat      2640
     ggtggcgctt ttctctggtg caggcttggc aggcttggca tgacaacaga ttcttctccc      2700
     gttgaacaag aaagtcagta atacctactg tggagttgtt agcacgcact gaatgccatt      2760
     tgcaagacct gtgctacaga gttgaaaagg aagtggactg ttattaccag gtagtcggat      2820
     agaattaaac ccacaatttt gaattgctgc tagaagttac aaataatttc tttgtcctag      2880
     ggccttcttg ttatgggttt tagagagtgg cagtgagttg ggtcttggct cctaagtgag      2940
     aaaccaagca cttgagtctc ttagactcta ggcctcactc cttggggctg gtgggtattg      3000
     cagtgtaaca tgggcctcgg gcatcccaaa aggggtgctg ggcagtatga ggaggtcctg      3060
     tttttacagt agtgttttct tggtcgttgt tgtccttcct ctaccttcag atcgccaccc      3120
     agctgcagct gggacccagg aaggagtcca ttgaaaacct gggaagaact tcagagtatt      3180
     gggttgtgga taaggtcact gccctaggta ggcccaacag gaagctctgg gtgaacagca      3240
     ttgtgccaga caactaagaa cagtgttaat tcctcaagaa gcagttcatc aagacagtgt      3300
     ccatccggaa ggaagctcac ctaggcttgt ggtagcaaca gcacatatca gcagccagac      3360
     gcactctctg gtcgtgcact ttgggacatg agtttgagac gcttcctcat gacacctaca      3420
     ggagtagagg tctttgggac tggtcatccc tcttcccaaa gcagggagac tctggttcaa      3480
     catagcacaa actcttaggg aaccgaatca ccaccaccac tgtagtccag taacttccct      3540
     tcggtgtgtg tgtgtgggca tgtgtgtgcc ctgtatgtct gcgcagctca ctaccaacag      3600
     cctccatgtg cacttgacct tgtggtgcct ccgggaactt tccaggttgg cacctgaatg      3660
     ccttactctc agcagtctga ggctcgcttg ctctgcgcac acatttcagt ctcctttttt      3720
     ggccctaggc tggttaggaa cctgtacacc ttcactctct catcattaaa tagtggcctt      3780
     tttcagtatt tcctctctcc cctctataag ttgctgaaat cacaaagcac acttttgggg      3840
     atcatagaag gttggggttc cagaaaggca tctctgtgat ggttccattc actatgggga      3900
     tttccctact tgctgtcttc ttgatttctc taataaaaag agccaaatgg aaaatgaaaa      3960
     aaaaaaaaa                                                              3969
//


spacer
spacer