spacer

EBI Dbfetch

ID   AY390263; SV 1; linear; mRNA; STD; MUS; 1122 BP.
XX
AC   AY390263;
XX
DT   01-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus CXC chemokine receptor 1-like protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1122
RX   DOI; 10.1016/j.molimm.2005.06.043.
RX   PUBMED; 16084593.
RA   Moepps B., Nuesseler E., Braun M., Gierschik P.;
RT   "A homolog of the human chemokine receptor CXCR1 is expressed in the
RT   mouse";
RL   Mol. Immunol. 43(7):897-914(2006).
XX
RN   [2]
RP   1-1122
RA   Moepps B., Nuessler E., Braun M., Gierschik P.;
RT   ;
RL   Submitted (13-SEP-2003) to the INSDC.
RL   Pharmacology and Toxicology, University of Ulm, Albert-Einstein-Allee 11,
RL   Ulm 89081, Germany
XX
DR   MD5; 9e5096a3aa4d9a40a075c11130588e55.
DR   Ensembl-Gn; ENSMUSG00000048480; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053389; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1122
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /map="1C2-3"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             49..1104
FT                   /codon_start=1
FT                   /product="CXC chemokine receptor 1-like protein"
FT                   /note="mCXCR1-like"
FT                   /db_xref="GOA:Q810W6"
FT                   /db_xref="InterPro:IPR000174"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR001355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2448715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810W6"
FT                   /protein_id="AAQ84305.1"
FT                   /translation="MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQ
FT                   ALVVFYALVSLLSLLGNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSK
FT                   LKGWIFGTPLCKMVSLLKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCV
FT                   GIWGLSLILSLPFAIFRQAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLT
FT                   MLVCYGLTLRMLFKTHMRQKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDT
FT                   CERRNDIDQALYITEILGFSHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRR
FT                   VAFHTSLTAIY"
XX
SQ   Sequence 1122 BP; 230 A; 303 C; 259 G; 330 T; 0 other;
     tcctcccgca cacaaggaac ggacccagct ggtgcctcag atcaaacaat ggccgaggct        60
     gaatatttca tctggactaa tcctgagggt gactttgaga aagaatttgg aaatatcacg       120
     ggaatgctgc ccactggaga ttatttcatt ccctgtaaga gagttccaat aaccaacagg       180
     caggctttag ttgtctttta tgcactggtg tcccttctga gcttgctggg aaactcgctg       240
     gtgatgctgg ttatcttata caggcgaagg acccgatccg tcatggatgt ctacgtgctg       300
     aacctagcca tcgccgacct actcttttca ttgaccctgc ccttcttggc tgtctccaaa       360
     ttgaagggct ggatttttgg cacacccctg tgcaagatgg tctcactcct gaaggaattc       420
     aacttcttca gtggtatcct gctgctggcc tgcatcagtg tggaccgata cctggccatc       480
     gtccatgcca cccgtacgct ggcccgaaag cgctacttgg ttaaattcgt gtgcgtgggc       540
     atctggggtc tatctttgat tctgtctctg ccttttgcta tcttccgcca ggcatataaa       600
     ccattccgtt ctggtacagt ctgctatgaa gtcctgggtg aagccacaac agattttcgg       660
     atgaccttgc ggggtctgtc ccacatattt ggcttcctcc tgccgctgct cactatgctg       720
     gtctgctacg ggctcacact gcgcatgctc tttaagaccc acatgaggca gaaacaccgg       780
     gccatggggg tgatctttgc tgttgtgttg gtcttcttgc tctgttgtct gccctacaat       840
     ctggttctgc tctcagacac tctcttagga gcccacttga ttgaagatac ttgcgaacgc       900
     cgcaatgaca ttgaccaggc cctgtatatt actgagatcc tgggcttttc tcatagttgt       960
     cttaacccta tcatctatgc cttcgttggc caaaattttc gccatgaatt cctcaagatc      1020
     cttgctaacc atggcctggt tcgcaaggag gttttgacac accgccgtgt tgcctttcat      1080
     acgtctctca ccgctattta ttaaacctct gagaattacc gg                         1122
//


spacer
spacer