Dbfetch

ID   AH013274; SV 2; linear; genomic DNA; STD; MUS; 3167 BP.
XX
AC   AH013274; AY389541-AY389545;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus strain SAMP1/YitFc peroxisome proliferator-activated receptor
DE   gamma 1 (Pparg) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3167
RA   Sugawara K., Olson T., Moskaluk C.A., Stevens B., Hoang S., Kozaiwa K.,
RA   Cominelli F., Ley K.F., McDuffie M.;
RT   "Susceptibility to Crohn's disease is linked to PPARgamma in mouse and
RT   man";
RL   Unpublished.
XX
RN   [2]
RP   1-3167
RA   Sugawara K., Olson T., Moskaluk C.A., Stevens B., Hoang S., Kozaiwa K.,
RA   Cominelli F., Ley K.F., McDuffie M.;
RT   ;
RL   Submitted (12-SEP-2003) to the INSDC.
RL   Gastroenterology and Hepatology, University of Virginia, MR4 Room 1111,
RL   Lane Road, Charlottesville, VA 22908, USA
XX
DR   MD5; 725e79b2d1eae06ea3ab92a701bbc8e3.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:37222503, gi:37222504, gi:37222505, gi:37222506, gi:37222507,
CC   gi:37222502.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3167
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /map="116.1 Mb; between Hrh1 and Mbd4"
FT                   /strain="SAMP1/YitFc"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..3167
FT                   /gene="Pparg"
FT   regulatory      1..>1493
FT                   /gene="Pparg"
FT                   /regulatory_class="promoter"
FT   gap             1494..1593
FT                   /estimated_length=unknown
FT   mRNA            join(1594..2013,2114..>2178)
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   1"
FT   exon            1594..2013
FT                   /gene="Pparg"
FT                   /number=A1
FT   gap             2014..2113
FT                   /estimated_length=unknown
FT   exon            2114..2178
FT                   /gene="Pparg"
FT                   /number=A2
FT   gap             2179..2278
FT                   /estimated_length=unknown
FT   mRNA            join(<2279..2729,2830..3167)
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   1"
FT   CDS             join(<2279..2729,2830..3077)
FT                   /codon_start=1
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   1"
FT                   /protein_id="AAQ89994.1"
FT                   /translation="PFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSV
FT                   EAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMT
FT                   REFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIED
FT                   IQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHP
FT                   LLQEIYKDLY"
FT   exon            2279..2729
FT                   /gene="Pparg"
FT                   /number=6
FT   gap             2730..2829
FT                   /estimated_length=unknown
FT   exon            2830..3167
FT                   /gene="Pparg"
FT                   /number=7
XX
SQ   Sequence 3167 BP; 801 A; 637 C; 707 G; 622 T; 400 other;
     aagttggcta cttacttact acatacttca tacatacata cttctcactg agtgtgggat        60
     gctgacccaa gtcaacatgg ccacttaatg acaggcatgg aaatggagtc tttgcatggt       120
     tagtaacatg gcctttagag tccctatatg aacctgacct gtgtcttatt atttgaggac       180
     ttaagagtgg aaggatgctg ggcagtggtg gcacatgcct ttaatcccag cccttgggag       240
     gcagaggcag gaggatttct gagtttgagg ccagcctggt ctacaaagtg agttccagga       300
     cagccagggc tacacagaga aactgtgtct caaaaaacca aaaccaaaaa aaaaaaaaaa       360
     atgtggaagg acatgaatct gttgattcaa gctctgaact ttctttataa tgtcatactc       420
     acaaatgtct ggtgaggatg gtttgtacca gaagaataaa gaattcccta cctcccaaca       480
     gataaggatg ctaagagtgg agaagcatct tgagcaagaa gcataattat aaatttccag       540
     aggccagtgc ctcctaaagg agagcaaaac atagagcaag gtcttcatca ttacgattgg       600
     aaaaggataa aagaacggcc tttggtgtcc tggacactgc aagctttctg aatgtgaatc       660
     tttaggacag atcatgactg tgagagctga aagagtgcaa gaaaaggaac tgtctatcat       720
     gtgggcttca ggctcccgag gcaagaagct ccaatagtct acttaaaaac aagagattct       780
     caggccctct ccaccctatg tgtaaggtct cctatgtaag aaatggtgct aaagaatttt       840
     aaaaagccag tgaacaaggt taacaaatag tttgaaggca ggagagattg ctcagcggtt       900
     aggaacactt tgtgttcttc cagaggaccc ttgttcggtt cccagcacca accacctgta       960
     actccagctc caggggagcc cacacctctc cctccgttca cgtgcataca cacacaattg      1020
     ttttttaaaa ggaaattaaa tgattagcac taaagtctgt tgattaaggc attcgccttc      1080
     ataacattct gagattaaaa ataaaaataa aactgagatt aaaaataaaa agaaaaaaag      1140
     aaaaaaggga gatcctaaat tcacttaatt catataaata tatatatggg tgtgtatcta      1200
     ttatatatca tatatcatat atatgatata taaatatatg ttatgtatga tatataaata      1260
     tatatggtat atatatagag agagagatga aaagcacatc taggaaaaaa acaaacttct      1320
     ccatgacaga catggacatg gacatcggtc tgagggacac gggaccttcc tgggtcgcct      1380
     cccagcggct ggtgaggagc aaggcggcca ggtaaccagc gcacggcgcc gggcgcggga      1440
     gggccacgcg ggcctcgtgg gcgccggcct ccgggtgcgg gcgcggggcc tccnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggcctca ccctgggcac cgcccccggt      1620
     ccggccgggt ggctcggctc ggctcctccg gtccgcggcc ggccaggcgg ggcccgtcgc      1680
     actcagagcg gcagccgcct ggggcgctcg ggtcgggtcg gcctcaccga cgcacagcac      1740
     ccgccaagcc gccgcctcag gtcagagtcg ccccgggcca cgcggcccgc cggagggacg      1800
     cggaagaaga gacctggggc gctgcgctgg ggtattgggt cgcgcgcagc ctgaggggac      1860
     cgagtgtgac gacaaggtga ccgggctgag gggacgggct gaggagaagt cacactctga      1920
     caggagcctg tgagaccaac agcctgacgg ggtctcggtt gaggggacgc gggctgagaa      1980
     gtcacgttct gacaggactg tgtgacagac aagnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnatttgaa agaagcggtg aaccactgat attcaggaca tttttaaaaa      2160
     caagactacc ctttactgnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnncc      2280
     atttgtcatc tacgacatga attccttaat gatgggagaa gataaaatca agttcaaaca      2340
     tatcaccccc ctgcaggagc agagcaaaga ggtggccatc cgaatttttc aagggtgcca      2400
     gtttcgatcc gtagaagccg tgcaagagat cacagagtat gccaaaaata tccctggttt      2460
     cattaacctt gatttgaatg accaagtgac tctgctcaag tatggtgtcc atgagatcat      2520
     ctacacgatg ctggcctccc tgatgaataa agatggagtc ctcatctcag agggccaagg      2580
     attcatgacc agggagttcc tcaaaagcct gcggaagccc tttggtgact ttatggagcc      2640
     taagtttgag tttgctgtga agttcaatgc actggaatta gatgacagtg acttggctat      2700
     atttatagct gtcattattc tcagtggagn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2760
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2820
     nnnnnnnnna ccgcccaggc ttgctgaacg tgaagcccat cgaggacatc caagacaacc      2880
     tgctgcaggc cctggaactg cagctcaagc tgaatcaccc agagtcctct cagctgttcg      2940
     ccaaggtgct ccagaagatg acagacctca ggcagatcgt cacagagcac gtgcagctac      3000
     tgcatgtgat caagaagaca gagacagaca tgagccttca ccccctgctc caggagatct      3060
     acaaggactt gtattagcag gaaagtccca cccgctgaca acgtgttcct tctattgatt      3120
     gcactattat tttgagggaa aaaaatctga cacctaagaa atttact                    3167
//