Dbfetch

ID   AH013272; SV 2; linear; genomic DNA; STD; MUS; 3150 BP.
XX
AC   AH013272; AY389528; AY389530; AY389532; AY389537; AY389539;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus strain AKR/J peroxisome proliferator-activated receptor gamma
DE   1 (Pparg) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3150
RA   Sugawara K., Olson T., Moskaluk C.A., Stevens B., Hoang S., Kozaiwa K.,
RA   Cominelli F., Ley K.F., McDuffie M.;
RT   "Susceptibility to Crohn's disease is linked to PPARgamma in mouse and
RT   man";
RL   Unpublished.
XX
RN   [2]
RP   1-3150
RA   Sugawara K., Olson T., Moskaluk C.A., Stevens B., Hoang S., Kozaiwa K.,
RA   Cominelli F., Ley K.F., McDuffie M.;
RT   ;
RL   Submitted (11-SEP-2003) to the INSDC.
RL   Gastroenterology and Hepatology, University of Virginia, MR4 Room 1111,
RL   Lane Road, Charlottesville, VA 22908, USA
XX
DR   MD5; b02ca3087b444767b4ac1a88bddf2285.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:37222489, gi:37222490, gi:37222491, gi:37222492, gi:37222493,
CC   gi:37222488.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3150
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /map="116.1 Mb; between Hrh1 and Mbd4"
FT                   /strain="AKR/J"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..3150
FT                   /gene="Pparg"
FT   regulatory      1..>1477
FT                   /gene="Pparg"
FT                   /regulatory_class="promoter"
FT   gap             1478..1577
FT                   /estimated_length=unknown
FT   mRNA            join(1578..1997,2098..>2161)
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   1"
FT   exon            1578..1997
FT                   /gene="Pparg"
FT                   /number=A1
FT   gap             1998..2097
FT                   /estimated_length=unknown
FT   exon            2098..2161
FT                   /gene="Pparg"
FT                   /number=A2
FT   gap             2162..2261
FT                   /estimated_length=unknown
FT   mRNA            join(<2262..2712,2813..3150)
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   1"
FT   CDS             join(<2262..2712,2813..3060)
FT                   /codon_start=1
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   1"
FT                   /protein_id="AAQ89992.1"
FT                   /translation="PFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSV
FT                   EAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMT
FT                   REFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIED
FT                   IQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHP
FT                   LLQEIYKDLY"
FT   exon            2262..2712
FT                   /gene="Pparg"
FT                   /number=6
FT   gap             2713..2812
FT                   /estimated_length=unknown
FT   exon            2813..3150
FT                   /gene="Pparg"
FT                   /number=7
XX
SQ   Sequence 3150 BP; 796 A; 633 C; 703 G; 618 T; 400 other;
     ggctacttac ttactacata cttcatacat acatacttct cacttagtgt gggatgctga        60
     tgacccaagt caacatggcc acttaatgac aggcatggaa atggagtctt tgcatggtta       120
     gtaacatggc ctttagagtc cctatatgaa cctgacctgt gtcttattat ttgaagactt       180
     aagagtggaa ggatgctggg cagtggtggc acatgccttt aatcccagcc cttgggaggc       240
     agaggcagga ggatttctga gtttgaggcc agcctggtct acaaagtgag ttccaggaca       300
     gccagggcta cacagagaaa ctgtgtctca aaaaaccaaa aaaaaaaaaa aaatgtggaa       360
     ggacatgaat ctgttgattc aagctctgaa ctttctttat aatgtcatac tcacaaatgt       420
     ctggtgagga tggtttgtac cagaagaata aagaattccc tacctcccaa cagataagga       480
     tgctaagagt ggagaagcat cgtgagcaag aagcataatt ataaatttcc agaggccagt       540
     gcctcctaaa ggagagcaaa acatagagca aggtcttcat cattacgatt ggaaaaggat       600
     aaaagaacgg cctttggtgt cctggacact gtaagctttc tgaatgtgaa tctttaggac       660
     agatcatgac tgtgagagct gaaagagtgc aagaaaagga actgtctatc atgtgggctt       720
     caggctcccg aggcaagaag ctccaatagt ctacttaaaa acaagagatt ctcaggccct       780
     ctccacccta tgtgtaaggt ctcctatgta agaaatggtg ctaaagaatt ttaaaaagcc       840
     agtgaacaag gttaacaaat agtttgaagg caggagagat tgctcagcgg ttaggaacac       900
     tttgtgttcg tccagaggac ctttgttcgg ttcccagcac caaccacctg taactccagc       960
     tccaggggag cccacacctc tccctccgtt cacgtgcata cacacacaat tgttttttaa      1020
     aaggaaatta aatgattagc actaaagtct gttgattaag gcattcgcct tcataacatt      1080
     ctgagattaa aaataaaaat aaaacagatt aaaaataaaa aaaaagaaaa aagggagatc      1140
     ctaaatacac ttaattcata taaatatata tatgggtgtg tatctattat atatcatata      1200
     tatgatatat aaatatatgt tatgcatgat atataaatat atatggtata tatatatata      1260
     tagagagaga gatgaaaagc acatctagga aaaaaacaaa cttccccatg acagacatgg      1320
     acatggacat cggtctgagg gacacgggac cttcctgggt cgcctcccag cggctgtgag      1380
     gagcaaggcg gccaggtaac cagcgcacgg cgccgggcgc gggagggcca cgcgggcctc      1440
     gtgggcgccg gcctccgggt gcgggcgcgg ggcctccnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnggc ctcaccctgg gcaccgcccc cggtccggcc gggtggctcg      1620
     gctcggctcc tctggtccgc ggcgggccag gcggggcccg tcgcactcag agcggcagcc      1680
     gcctggggcg ctcgggtcgg gtcggcctca ccgacgcaca gcacccgcca agccgccgcc      1740
     tcaggtcaga gtcgccccgg gccacgcggc ccgccggagg gacgcggaag aagagacctg      1800
     gggcgctgcg ctggggtatt gggtcgcgcg cagcctgagg ggaccgagtg tgacgacaag      1860
     gtgaccgggc tgaggggacg ggctgaggag aagtcactct ctgacaggag cctgtgagac      1920
     cgacagcctg acggggtctc ggttgagggg acgcgggctg agaaatcacg ttctgacaga      1980
     actgtgtgac agacaagnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnatt      2100
     tgaaagaagc ggtgaaccac tgatattcag gacattttaa aaacaagact accctttact      2160
     gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nccatttgtc atctacgaca      2280
     tgaattcctt aatgatggga gaagataaaa tcaagttcaa acatatcacc cccctgcagg      2340
     agcagagcaa agaagtggcc atccgaattt ttcaagggtg ccagtttcga tccgtagaag      2400
     ctgtgcaaga gatcacagag tatgccaaaa atatccccgg tttcattaac cttgacttga      2460
     atgaccaagt gactctgctc aagtatggtg tccatgagat catctacacg atgctggcct      2520
     ccctgatgaa taaagatgga gtcctcatct cagagggcca aggattcatg accagggagt      2580
     tcctcaaaag cctgcggaag ccctttggtg actttatgga gcctaagttt gagtttgctg      2640
     tgaagttcaa tgcactggaa ttagatgaca gtgatttggc tatatttata gctgtcatta      2700
     ttctcagtgg agnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2760
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnaccgccca      2820
     ggcttgctga acgtgaagcc catcgaggac atccaagaca acctgctgca ggccctggaa      2880
     ctgcagctca agctgaacca cccagagtcc tctcagctgt tcgccaaggt gctccagaag      2940
     atgacagacc tcaggcagat cgtcacagag cacgtgcagc tactgcatgt gatcaagaag      3000
     acagagacag acatgagcct tcaccccctg ctccaggaga tctacaagga cttgtattag      3060
     caggaaagtc ccacccgctg acaacgtgtt ccttctattg attgcactat tattttgagg      3120
     gaaaaaaatc tgacacctaa gaaatttact                                       3150
//