spacer

EBI Dbfetch

ID   AY389532; SV 1; linear; genomic DNA; STD; MUS; 338 BP.
XX
AC   AY389532;
XX
DT   09-OCT-2003 (Rel. 77, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus AKR/J peroxisome proliferator-activated receptor gamma 1
DE   (Pparg) gene, exon 7 and partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-338
RA   Sugawara K., Olson T., Moskaluk C.A., Stevens B., Hoang S., Kozaiwa K.,
RA   Cominelli F., Ley K.F., McDuffie M.;
RT   "Susceptibility to Crohn's disease is linked to PPARgamma in mouse and
RT   man";
RL   Unpublished.
XX
RN   [2]
RP   1-338
RA   Sugawara K., Olson T., Moskaluk C.A., Stevens B., Hoang S., Kozaiwa K.,
RA   Cominelli F., Ley K.F., McDuffie M.;
RT   ;
RL   Submitted (11-SEP-2003) to the INSDC.
RL   Gastroenterology and Hepatology, University of Virginia, MR4 Room 1111,
RL   Lane Road, Charlottesville, VA 22908, USA
XX
DR   MD5; eb86878e651737ba45d37ce828c17132.
DR   Ensembl-Gn; ENSMUSG00000000440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171644; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..338
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /map="116.1 Mb; between Hrh1 and Mbd4"
FT                   /strain="AKR/J"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            order(AY389539.1:1..1477,AY389537.1:1..420,
FT                   AY389528.1:1..64,AY389530.1:1..451,1..338)
FT                   /gene="Pparg"
FT   mRNA            join(AY389530.1:<1..451,1..338)
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   1"
FT   CDS             join(AY389530.1:<1..451,1..248)
FT                   /codon_start=1
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   1"
FT                   /db_xref="GOA:Q6TQE4"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="UniProtKB/TrEMBL:Q6TQE4"
FT                   /protein_id="AAQ89992.1"
FT                   /translation="PFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSV
FT                   EAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMT
FT                   REFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIED
FT                   IQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHP
FT                   LLQEIYKDLY"
FT   exon            1..338
FT                   /gene="Pparg"
FT                   /number=7
XX
SQ   Sequence 338 BP; 98 A; 96 C; 76 G; 68 T; 0 other;
     accgcccagg cttgctgaac gtgaagccca tcgaggacat ccaagacaac ctgctgcagg        60
     ccctggaact gcagctcaag ctgaaccacc cagagtcctc tcagctgttc gccaaggtgc       120
     tccagaagat gacagacctc aggcagatcg tcacagagca cgtgcagcta ctgcatgtga       180
     tcaagaagac agagacagac atgagccttc accccctgct ccaggagatc tacaaggact       240
     tgtattagca ggaaagtccc acccgctgac aacgtgttcc ttctattgat tgcactatta       300
     ttttgaggga aaaaaatctg acacctaaga aatttact                               338
//


spacer
spacer