spacer

EBI Dbfetch

ID   AY375871; SV 1; linear; genomic DNA; STD; HUM; 5599 BP.
XX
AC   AY375871;
XX
DT   01-SEP-2004 (Rel. 81, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens 10IHWS 9010 AMAI MHC class II antigen (HLA-DQB1) gene,
DE   HLA-DQB1*0602 allele, exons 1 through 4, and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5599
RA   Wood J.M., Simons M.J., Ashdown M.L.;
RT   "Comparative haplotype analysis of polymorphism within the DQB1 gene.
RT   Continuous sequencing from promoter to exon 4";
RL   Unpublished.
XX
RN   [2]
RP   1-5599
RA   Wood J.M., Simons M.J., Ashdown M.L.;
RT   ;
RL   Submitted (25-AUG-2003) to the INSDC.
RL   GeneType Pty Ltd, 60-66 Hanover Street, Fitzroy, Victoria 3065, Australia
XX
DR   MD5; baa1b9a823d2669f682beee8eb446fde.
DR   EPD; EP16068; HS_HLA-DQB1.
DR   Ensembl-Gn; ENSG00000179344; homo_sapiens.
DR   Ensembl-Tr; ENST00000374943; homo_sapiens.
DR   Ensembl-Tr; ENST00000399084; homo_sapiens.
DR   Ensembl-Tr; ENST00000434651; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5599
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DQB1*0602 DQA1*01021 DRB1*1503"
FT                   /cell_line="10IHWS 9010 AMAI"
FT                   /db_xref="taxon:9606"
FT   gene            <410..>5599
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT   mRNA            join(<410..518,1950..2219,4769..5050,5560..>5599)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /product="MHC class II antigen"
FT   CDS             join(410..518,1950..2219,4769..5050,5560..>5599)
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q67AI9"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q67AI9"
FT                   /protein_id="AAQ88045.1"
FT                   /translation="MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKG
FT                   MCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTR
FT                   AELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRW
FT                   FRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
FT                   QSESAQSKMLSG"
FT   exon            <410..518
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /number=1
FT   exon            1950..2219
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /number=2
FT   exon            4769..5050
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /number=3
FT   exon            5560..>5599
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /number=4
XX
SQ   Sequence 5599 BP; 1450 A; 1270 C; 1333 G; 1546 T; 0 other;
     aatttgcttt attaaaaatc ccaagtataa taacaactgg tttttaacaa tattacagag        60
     atgtttactg ttgaatcgca tttttttctt ttgcctctca aaatccccga ggcattcgtt       120
     cttcagctct tctataatcg agaggaaatt ttcacctcag atgttcatcc agtacaattt       180
     gaagacgtca cagtgccagg cactggattg agaaccttca caaaaaaaat gtctgcccag       240
     agacagatga ggtccttcag ctccagtgct gattggttct tttccgaggg accatccaat       300
     cctgccactc acggaaacat ccacaggttt ttattctttc tgccaggtac atcagatcca       360
     tcaggtccga gctgtgttga ctaccactgc ttttcccttc gtctcagtta tgtcttggaa       420
     gaaggctttg cggatccccg gagaccttcg ggtagcaact gtcaccttga tgctggcgat       480
     gctgagctcc ctactggctg agggcagaga ctctcccggt aagtgcaggg cagctgctct       540
     ccagagccgc cactctggga acaggctctc cttgggctgg ggtatggggg atggtgatct       600
     ctatgatctt ggacacaatc tttcatcaac atttcctctc tcttgggaaa gaaagctatg       660
     ttgcattccc atttatcttt tagtgatgag atgaggacaa tccaatcccc atcctacagg       720
     cttaagcctg gaagaggagg agagaggaga gaaagaggag ataaagtgta catttactac       780
     cagcgatagg acaaagtgag catggggtta tttttgaaga tatgaatttc tccaaagaca       840
     cagcaggatt tgtcatttag gcgtgcccca agactgcctg gacttaggat tatgagatcc       900
     tgcattggaa aatgtgaggc agcaatggtg tctgtagtct ctgtatttga ggaaaatttg       960
     tctctattcc tgaccgagtg gagcatttgt ggaggcaaaa tcttggtgct gagggaagct      1020
     gactggctga ccacagagag ggagtcttcg ggtttcactg atttatgggc aaatggtgac      1080
     ttgagtggga ttcagagacc cgagttaatg gtggactgaa tttagtagga aggaggatgt      1140
     aaagaaggga aataacacat attgtgaaac cactcacttc agacagaaca atactttata      1200
     taacttctct ctcactcctt ctaacatcct gtgtgtagat atcatgattt tcttttacac      1260
     aattatactt gtgatatgga tattctgtta cataacctgc ccaaactggt gactgccaca      1320
     gtttaattgg aatctagttt atcaaattca aaagcttgtg ctctttccat gaataaatgt      1380
     ctctatctag gactcagagg tgtaggtcct ttccaacata gaagggagtg aacctcaacg      1440
     ggacttggga gggtaaatct aggcatggga aggaaggtat tttacccagg gaccaagaga      1500
     atacgcgtgt cagaacgagg ccaggcttaa ttcctggacc tatctcgtca ttccgttgaa      1560
     ctctcagatt tatgtggata actttatctc tgaggtatcc aggagcttca tgaaaaatgg      1620
     gatttcatgc gagaacgccc tgatccctct aagtgcagag gtgcatgtaa aatcagcccg      1680
     actgcctctt cgctgggttc acaggctcag gcagggacag ggctttcctc cctttcctgg      1740
     atgtaggaag gcagattcca gaagcccgca aagaaggcgg gcagagctgg gcagagccgc      1800
     cgggaggatc ccaggtctgg agcgccaggc acgggcgggc gggaactgga ggtcgcgcgg      1860
     gcggttccac agctccaggc cgggtcaggg cggcggctgc gggggcggcc gggctggggc      1920
     ctgactgacc ggccggtgat tccccgcaga ggatttcgtg ttccagttta agggcatgtg      1980
     ctacttcacc aacgggacgg agcgcgtgcg tcttgtgacc agatacatct ataaccgaga      2040
     ggagtacgcg cgcttcgaca gcgacgtggg ggtgtaccgc gcggtgacgc cgcaggggcg      2100
     gcctgatgcc gagtactgga acagccagaa ggaagtcctg gaggggaccc gggcggagtt      2160
     ggacacggtg tgcagacaca actacgaggt ggcgttccgc gggatcttgc agaggagagg      2220
     tgagcgtcgt cgcccctccg tgaggcccac ccttggccga gaccccgagt ttctgtgccg      2280
     ggaggggcga tgggggcgag gtctctgaaa tctgagccca gttcattcca ccccagggga      2340
     aaggaggcgg cggcggggtg gtgggggcag gtgcatcgga ggggcgggga cctagggcag      2400
     agcaggggga caagcagagt tggccaggct gcctagtgtc ccccccagcc tccccgtccg      2460
     tcggcctcgt cctccgctct gcacgtttct cgcctcgtgc cttatgtgtt tgcctcctcg      2520
     taccttacct tcgctaagca gttctctctg cccccagtgc ccaccctctt cccctgcccg      2580
     ccggcctcgc tagcactgcc ccacccagca aggcccacgt gcgcagcttg cgccgcagga      2640
     agcttcaggc ttggcctggt ggagttaggg ctgccccaca gctgcgcgca gggcatccag      2700
     caattacagt tgcgaaataa gatattttga ctttttggct tcaaatcatt attcatcgta      2760
     attctgtttt cttaaatggc taccactaat ggcggagatc tttgaggcga gagactgttt      2820
     aattattgca tgcctggtac ctgacacatt gactggtatg tggtgtgagc tcaatgatct      2880
     tctgttaaat tcatgaataa atgtactcag ctgccaatcc agttaggttc aagaaaaaaa      2940
     cagaggctta caaatgaact ttatcaatta ttttctaaca ttttgcttaa tgctttcaag      3000
     taaactctta ctgacttgga tcttaataga atttgtgaat acaaagtctg aggaaaatgt      3060
     gtttgctaaa aataaaaaca atgcttgaat gatgttgtaa ggcagagttt taatttctta      3120
     gaaaagctga acaaatagca ctatgcaaag atcagaagtt tgggaataaa taggttgaag      3180
     ctattaaatt attggataaa aatagtttca ggttgctttt ggcctaggtt atcccctccc      3240
     ccccatcact atccacttca ggaataaaca ttctgaaagt caattttacc cattcaggaa      3300
     gcacttattt ctagacagtt gccttatcaa ataccatcta tgttatgtca tttaatctca      3360
     cagctacctg tgcattagag attagcatca ccactttata tatcctaata ttggtacatg      3420
     ataaacactt taagtaatca gcccacaatt actcaccaag atcttaagcc tcccaaagta      3480
     cacaacattc ttatgttcct cactacacat atgtagagtc taagggatgt aaggccttgt      3540
     taaagccagt tttgaccaga agcagcaatg agtctattcc tgtttgttct gtgtgttaat      3600
     gcggcattga aaattcatga ttaatcaatc cctagtctga ccccggtgtt atctatgcag      3660
     gttcacaaaa cttttagttt gctttacact cccttgcctt cttttgactc acatcctaat      3720
     gccagcaagt acttatattt ttgctatttc agttttattt ccataaaatt tattttatca      3780
     tcttttctca taaatttgtg ccctctattt ttactcccag tctgttgaag atgaacaaat      3840
     cttataaggc cacatagctg actctgattt cagttggcct ccaggaagga gaacctaaag      3900
     aaaagttcaa gtccaagcag aaaccatgat tccttccgga tgatggctca agagtgccat      3960
     ttaattgggg tgccacctgc tgacctcagc aaatcccagt tatatgtata tgttcacatt      4020
     acaggctcat tagcccaggc cgacctctgc acggatctca gaatattttc tgtggagaac      4080
     atacacgata atgtctgatt tcagaacaag aaagtaattg tcaatagcaa ggaaatggag      4140
     tagggtagac agctagtaat taaactcact tgtgcgttaa aaagaaatta aggaaaaaaa      4200
     gaaaatgaga gaacatatta ctaaataaag aaagcacaca ttaaatattt gctatagttt      4260
     cacactaaga gaataaagga aatgtgataa agtggcctaa aaggaaagga tgagatgtgt      4320
     aaaagaggcg gggaaagatg tgtcattttt tttactatga gcagcaatct gagaagataa      4380
     aggaattgag ttgtggacaa acatgatgtt tgatcaaggg ttatttgttt tgaaggcctg      4440
     cctacttttt tttcaaatat tacaaacttt tgaaataaca ttctactttt ttttcaaata      4500
     ttacaaactt ttgaaataac attctttttg ttttttgctg tctgttacta gattgcacat      4560
     tctataaatg cagggaccat agtatgttat ttatctttga attctcagtg attgtcaaat      4620
     ttatatttgt tgaatgaacc ttaatccaag acttcgactc caggtatctt tccactctgg      4680
     tccaaggagg gatccttcct catggtagac gtggtgtgtg ttctcacatc tcactcctat      4740
     gtcttttcct gtctgttact gccctcagtg gagcccacag tgaccatctc cccatccagg      4800
     acagaggccc tcaaccacca caacctgctg gtctgctcgg tgacagattt ctatccaggc      4860
     cagatcaaag tccggtggtt tcggaatgat caggaggaga cagccggcgt tgtgtccacc      4920
     ccccttatta ggaatggtga ctggactttc cagatcctgg tgatgctgga aatgactccc      4980
     cagcgtggag atgtctacac ctgccacgtg gagcacccca gcctccagag ccccatcacc      5040
     gtggagtggc gtaaggggat attgagtttc tgttactatg ggcccacaag acaaagagct      5100
     ccttctgacc cattccttcc catctcttat ccctgatgtc actactgagc tgggaatcac      5160
     aggagactag agcacctctt gctccatggc aagtgcatca gaagaatcct ggtctcatca      5220
     cctttccaga tgctagggaa attactctac atactgttgc tctgaatccc agtcctgata      5280
     gctctgaggg actgattctt agggctggtg actgggatct tagggtctaa ggttatggat      5340
     gagttcttga agagcagaga tttgcttccc cactctctca cctattcact gtatccaagg      5400
     acctattggc tggtctttcc cctccttagg ggtggtctga atggagaact aggttccttt      5460
     gatgccttca ccttctgcac ctcagactgg acttcaactc ctcagcaggg atgctatggg      5520
     gtgtggggac aaacacagac actcagttct gctctttagg ggctcagtct gaatctgccc      5580
     agagcaagat gctgagtgg                                                   5599
//


spacer
spacer