Dbfetch

ID   AY375870; SV 1; linear; genomic DNA; STD; HUM; 5425 BP.
XX
AC   AY375870;
XX
DT   01-SEP-2004 (Rel. 81, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens 4AOH 100040 WAL FD MHC class II antigen (HLA-DQB1) gene,
DE   HLA-DQB1*0602 allele, exons 1 through 4, and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5425
RA   Wood J.M., Simons M.J., Ashdown M.L.;
RT   "Comparative haplotype analysis of polymorphism within the DQB1 gene.
RT   Continuous sequencing from promoter to exon 4";
RL   Unpublished.
XX
RN   [2]
RP   1-5425
RA   Wood J.M., Simons M.J., Ashdown M.L.;
RT   ;
RL   Submitted (25-AUG-2003) to the INSDC.
RL   GeneType Pty Ltd, 60-66 Hanover Street, Fitzroy, Victoria 3065, Australia
XX
DR   MD5; 6943e3599b7d66af205fa371a55ae811.
DR   EPD; EP16068; HS_HLA-DQB1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5425
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DQB1*0602 DQA1*01021 DRB1*15011"
FT                   /cell_line="4AOH 100040 WAL FD"
FT                   /db_xref="taxon:9606"
FT   gene            <236..>5425
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT   mRNA            join(<236..344,1776..2045,4595..4876,5386..>5425)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /product="MHC class II antigen"
FT   CDS             join(236..344,1776..2045,4595..4876,5386..>5425)
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q67AJ0"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q67AJ0"
FT                   /protein_id="AAQ88044.1"
FT                   /translation="MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKG
FT                   MCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTR
FT                   AELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRW
FT                   FRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
FT                   QSESAQSKMLSG"
FT   exon            <236..344
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /number=1
FT   exon            1776..2045
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /number=2
FT   exon            4595..4876
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /number=3
FT   exon            5386..>5425
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0602"
FT                   /number=4
XX
SQ   Sequence 5425 BP; 1399 A; 1235 C; 1310 G; 1481 T; 0 other;
     caatttgaag acgtcacagt gccaggcact ggattgagaa ccttcacaaa aaaaatgtct        60
     gcccagagac agatgaggtc cttcagctcc agtgctgatt ggttcttttc cgagggacca       120
     tccaatcctg ccactcacgg aaacatccac aggtttttat tctttctgcc aggtacatca       180
     gatccatcag gtccgagctg tgttgactac cactgctttt cccttcgtct cagttatgtc       240
     ttggaagaag gctttgcgga tccccggaga ccttcgggta gcaactgtca ccttgatgct       300
     ggcgatgctg agctccctac tggctgaggg cagagactct cccggtaagt gcagggcagc       360
     tgctctccag agccgccact ctgggaacag gctctccttg ggctggggta tgggggatgg       420
     tgatctctat gatcttggac acaatctttc atcaacattt cctctctctt gggaaagaaa       480
     gctatgttgc attcccattt atcttttagt gatgagatga ggacaatcca atccccatcc       540
     tacaggctta agcctggaag aggaggagag aggagagaaa gaggagataa agtgtacatt       600
     tactaccagc gataggacaa agtgagcatg gggttatttt tgaagatatg aatttctcca       660
     aagacacagc aggatttgtc atttaggcgt gccccaagac tgcctggact taggattatg       720
     agatcctgca ttggaaaatg tgaggcagca atggtgtctg tagtctctgt atttgaggaa       780
     aatttgtctc tattcctgac cgagtggagc atttgtggag gcaaaatctt ggtgctgagg       840
     gaagctgact ggctgaccac agagagggag tcttcgggtt tcactgattt atgggcaaat       900
     ggtgacttga gtgggattca gagacccgag ttaatggtgg actgaattta gtaggaagga       960
     ggatgtaaag aagggaaata acacatattg tgaaaccact cacttcagac agaacaatac      1020
     tttatataac ttctctctca ctccttctaa catcctgtgt gtagatatca tgattttctt      1080
     ttacacaatt atacttgtga tatggatatt ctgttacata acctgcccaa actggtgact      1140
     gccacagttt aattggaatc tagtttatca aattcaaaag cttgtgctct ttccatgaat      1200
     aaatgtctct atctaggact cagaggtgta ggtcctttcc aacatagaag ggagtgaacc      1260
     tcaacgggac ttgggagggt aaatctaggc atgggaagga aggtatttta cccagggacc      1320
     aagagaatac gcgtgtcaga acgaggccag gcttaattcc tggacctatc tcgtcattcc      1380
     gttgaactct cagatttatg tggataactt tatctctgag gtatccagga gcttcatgaa      1440
     aaatgggatt tcatgcgaga acgccctgat ccctctaagt gcagaggtgc atgtaaaatc      1500
     agcccgactg cctcttcgct gggttcacag gctcaggcag ggacagggct ttcctccctt      1560
     tcctggatgt aggaaggcag attccagaag cccgcaaaga aggcgggcag agctgggcag      1620
     agccgccggg aggatcccag gtctggagcg ccaggcacgg gcgggcggga actggaggtc      1680
     gcgcgggcgg ttccacagct ccaggccggg tcagggcggc ggctgcgggg gcggccgggc      1740
     tggggcctga ctgaccggcc ggtgattccc cgcagaggat ttcgtgttcc agtttaaggg      1800
     catgtgctac ttcaccaacg ggacggagcg cgtgcgtctt gtgaccagat acatctataa      1860
     ccgagaggag tacgcgcgct tcgacagcga cgtgggggtg taccgcgcgg tgacgccgca      1920
     ggggcggcct gatgccgagt actggaacag ccagaaggaa gtcctggagg ggacccgggc      1980
     ggagttggac acggtgtgca gacacaacta cgaggtggcg ttccgcggga tcttgcagag      2040
     gagaggtgag cgtcgtcgcc cctccgtgag gcccaccctt ggccgagacc ccgagtttct      2100
     gtgccgggag gggcgatggg ggcgaggtct ctgaaatctg agcccagttc attccacccc      2160
     aggggaaagg aggcggcggc ggggtggtgg gggcaggtgc atcggagggg cggggaccta      2220
     gggcagagca gggggacaag cagagttggc caggctgcct agtgtccccc ccagcctccc      2280
     cgtccgtcgg cctcgtcctc cgctctgcac gtttctcgcc tcgtgcctta tgtgtttgcc      2340
     tcctcgtacc ttaccttcgc taagcagttc tctctgcccc cagtgcccac cctcttcccc      2400
     tgcccgccgg cctcgctagc actgccccac ccagcaaggc ccacgtgcgc agcttgcgcc      2460
     gcaggaagct tcaggcttgg cctggtggag ttagggctgc cccacagctg cgcgcagggc      2520
     atccagcaat tacagttgcg aaataagata ttttgacttt ttggcttcaa atcattattc      2580
     atcgtaattc tgttttctta aatggctacc actaatggcg gagatctttg aggcgagaga      2640
     ctgtttaatt attgcatgcc tggtacctga cacattgact ggtatgtggt gtgagctcaa      2700
     tgatcttctg ttaaattcat gaataaatgt actcagctgc caatccagtt aggttcaaga      2760
     aaaaaacaga ggcttacaaa tgaactttat caattatttt ctaacatttt gcttaatgct      2820
     ttcaagtaaa ctcttactga cttggatctt aatagaattt gtgaatacaa agtctgagga      2880
     aaatgtgttt gctaaaaata aaaacaatgc ttgaatgatg ttgtaaggca gagttttaat      2940
     ttcttagaaa agctgaacaa atagcactat gcaaagatca gaagtttggg aataaatagg      3000
     ttgaagctat taaattattg gataaaaata gtttcaggtt gcttttggcc taggttatcc      3060
     cctccccccc atcactatcc acttcaggaa taaacattct gaaagtcaat tttacccatt      3120
     caggaagcac ttatttctag acagttgcct tatcaaatac catctatgtt atgtcattta      3180
     atctcacagc tacctgtgca ttagagatta gcatcaccac tttatatatc ctaatattgg      3240
     tacatgataa acactttaag taatcagccc acaattactc accaagatct taagcctccc      3300
     aaagtacaca acattcttat gttcctcact acacatatgt agagtctaag ggatgtaagg      3360
     ccttgttaaa gccagttttg accagaagca gcaatgagtc tattcctgtt tgttctgtgt      3420
     gttaatgcgg cattgaaaat tcatgattaa tcaatcccta gtctgacccc ggtgttatct      3480
     atgcaggttc acaaaacttt tagtttgctt tacactccct tgccttcttt tgactcacat      3540
     cctaatgcca gcaagtactt atatttttgc tatttcagtt ttatttccat aaaatttatt      3600
     ttatcatctt ttctcataaa tttgtgccct ctatttttac tcccagtctg ttgaagatga      3660
     acaaatctta taaggccaca tagctgactc tgatttcagt tggcctccag gaaggagaac      3720
     ctaaagaaaa gttcaagtcc aagcagaaac catgattcct tccggatgat ggctcaagag      3780
     tgccatttaa ttggggtgcc acctgctgac ctcagcaaat cccagttata tgtatatgtt      3840
     cacattacag gctcattagc ccaggccgac ctctgcacgg atctcagaat attttctgtg      3900
     gagaacatac acgataatgt ctgatttcag aacaagaaag taattgtcaa tagcaaggaa      3960
     atggagtagg gtagacagct agtaattaaa ctcacttgtg cgttaaaaag aaattaagga      4020
     aaaaaagaaa atgagagaac atattactaa ataaagaaag cacacattaa atatttgcta      4080
     tagtttcaca ctaagagaat aaaggaaatg tgataaagtg gcctaaaagg aaaggatgag      4140
     atgtgtaaaa gaggcgggga aagatgtgtc atttttttta ctatgagcag caatctgaga      4200
     agataaagga attgagttgt ggacaaacat gatgtttgat caagggttat ttgttttgaa      4260
     ggcctgccta cttttttttc aaatattaca aacttttgaa ataacattct actttttttt      4320
     caaatattac aaacttttga aataacattc tttttgtttt ttgctgtctg ttactagatt      4380
     gcacattcta taaatgcagg gaccatagta tgttatttat ctttgaattc tcagtgattg      4440
     tcaaatttat atttgttgaa tgaaccttaa tccaagactt cgactccagg tatctttcca      4500
     ctctggtcca aggagggatc cttcctcatg gtagacgtgg tgtgtgttct cacatctcac      4560
     tcctatgtct tttcctgtct gttactgccc tcagtggagc ccacagtgac catctcccca      4620
     tccaggacag aggccctcaa ccaccacaac ctgctggtct gctcggtgac agatttctat      4680
     ccaggccaga tcaaagtccg gtggtttcgg aatgatcagg aggagacagc cggcgttgtg      4740
     tccacccccc ttattaggaa tggtgactgg actttccaga tcctggtgat gctggaaatg      4800
     actccccagc gtggagatgt ctacacctgc cacgtggagc accccagcct ccagagcccc      4860
     atcaccgtgg agtggcgtaa ggggatattg agtttctgtt actatgggcc cacaagacaa      4920
     agagctcctt ctgacccatt ccttcccatc tcttatccct gatgtcacta ctgagctggg      4980
     aatcacagga gactagagca cctcttgctc catggcaagt gcatcagaag aatcctggtc      5040
     tcatcacctt tccagatgct agggaaatta ctctacatac tgttgctctg aatcccagtc      5100
     ctgatagctc tgagggactg attcttaggg ctggtgactg ggatcttagg gtctaaggtt      5160
     atggatgagt tcttgaagag cagagatttg cttccccact ctctcaccta ttcactgtat      5220
     ccaaggacct attggctggt ctttcccctc cttaggggtg gtctgaatgg agaactaggt      5280
     tcctttgatg ccttcacctt ctgcacctca gactggactt caactcctca gcagggatgc      5340
     tatggggtgt ggggacaaac acagacactc agttctgctc tttaggggct cagtctgaat      5400
     ctgcccagag caagatgctg agtgg                                            5425
//