spacer

EBI Dbfetch

ID   AY351677; SV 1; linear; mRNA; STD; MUS; 1257 BP.
XX
AC   AY351677;
XX
DT   30-AUG-2003 (Rel. 77, Created)
DT   20-MAY-2004 (Rel. 79, Last updated, Version 2)
XX
DE   Mus musculus galanin receptor-like protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1257
RX   DOI; 10.1016/j.neuropharm.2004.02.004.
RX   PUBMED; 15111018.
RA   Ignatov A., Hermans-Borgmeyer I., Schaller H.C.;
RT   "Cloning and characterization of a novel G-protein-coupled receptor with
RT   homology to galanin receptors";
RL   Neuropharmacology 46(8):1114-1120(2004).
XX
RN   [2]
RP   1-1257
RA   Ignatov A., Schaller H.C.;
RT   "Molecular cloning of a novel G-protein-coupled receptor";
RL   Unpublished.
XX
RN   [3]
RP   1-1257
RA   Ignatov A., Schaller H.C.;
RT   ;
RL   Submitted (26-JUL-2003) to the INSDC.
RL   Entwicklungsbiologie, Zentrum fuer Molekulare Neurobiologie, Martinistr.
RL   52, Hamburg 22246
XX
DR   MD5; f897fca41159fc76cab55830ed53fa84.
DR   Ensembl-Gn; ENSMUSG00000042816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054738; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1257
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /map="18B3"
FT                   /strain="C3H/He"
FT                   /mol_type="mRNA"
FT                   /cell_line="P19 teratocarcinoma"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1257
FT                   /codon_start=1
FT                   /product="galanin receptor-like protein"
FT                   /db_xref="GOA:Q7TSN6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441887"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7TSN6"
FT                   /protein_id="AAQ62568.1"
FT                   /translation="MLRAGFADTNSSNMNESFARLHFAGGYLPSDSKDWRTIIPSLLMA
FT                   VCLVGLVGNLCVIGILLHGVWKRKPSTIHSLILNLSLADFSLLLFSAPVRAAAYSKGVW
FT                   DLGWFICKSSDWFTHVCMAAKSLTFVVVAKACFAYASDPAKQESIHSRTIWSVLAGIWV
FT                   VASLLPLPEWLFSTTRRHAGVEMCLVDVPAVAEEFMSMFGKLYPLLVFCLPLLLAGVYF
FT                   WRAYDQCKTRCTKTRNLRDQMRSKQLTVMLLSTAIISALLWLPEWIAWLWVWHVKAGGP
FT                   MPPQGFIALSQVLMFFTSTANPLIFLVMSEEFKAGLKGLWKWMITRKPAVTSEVQEAPA
FT                   GNTEALPGKAPSPETQTCILDTDGRGSPDDSKEKSGKVVAPILPDVEQFWHERDAVPSA
FT                   QDNDPIPWEHEGQETEGCN"
XX
SQ   Sequence 1257 BP; 286 A; 338 C; 329 G; 304 T; 0 other;
     atgctgagag ctgggtttgc cgacaccaat tccagcaaca tgaacgagtc gtttgctcgc        60
     ctccactttg caggaggcta cctgccgtct gactccaagg actggaggac catcattccg       120
     tctctcttga tggccgtgtg cctggtgggt ctcgtgggaa acctgtgtgt gattggcatt       180
     ctccttcatg gcgtttggaa aagaaagcca tccacgatcc actccctgat tctgaatcta       240
     agcctggctg acttctctct cctgctcttc tctgcacctg tccgagcggc agcatactcc       300
     aagggcgttt gggatctcgg ctggttcatc tgcaagtcct ctgactggtt cacccacgtg       360
     tgcatggcag ccaagagctt gacatttgtt gtggtagcca aagcatgctt cgcgtatgca       420
     agtgacccag ccaagcaaga gagtatccac agccgcacca tctggtcagt gctggcgggc       480
     atctgggttg tagccagcct gcttcccctg ccagaatggc tctttagcac caccagacgt       540
     cacgcaggtg tggaaatgtg cctcgtggat gtgccagctg tggcagaaga attcatgtcc       600
     atgttcggta agctctaccc tctgctggtg ttctgccttc ctttacttct ggctggcgtt       660
     tatttctggc gagcttatga ccaatgtaag acacgatgta cgaaaactcg aaatctgaga       720
     gaccagatgc gttcaaagca actcacagtg atgctgctaa gcactgcaat catctctgct       780
     cttctgtggc tcccagagtg gatagcctgg ctgtgggtat ggcatgtgaa ggctggaggg       840
     ccgatgccac cacaggggtt catagccctg tctcaagttc tcatgttttt cacctccaca       900
     gcaaaccctc tcatttttct agttatgtct gaagagttca aggcaggctt gaaaggccta       960
     tggaaatgga tgataaccag aaagccagca gttacttcag aggttcagga ggcacctgct      1020
     ggaaacacag aggcccttcc cggaaaggct ccatcaccag agacccaaac atgcatccta      1080
     gacacagacg gacgtgggtc tcctgatgac agcaaagaga aatctggtaa ggtggtggct      1140
     cccatcctcc ctgacgtgga gcagttttgg cacgagaggg atgctgtccc ttcagcacaa      1200
     gacaatgacc ctataccctg ggaacacgaa ggccaagaga cagagggctg caattaa         1257
//


spacer
spacer