spacer

EBI Dbfetch

ID   AY331133; SV 1; linear; mRNA; STD; MUS; 7953 BP.
XX
AC   AY331133;
XX
DT   21-JUL-2003 (Rel. 76, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus myosin XVA isoform 2a mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7953
RX   DOI; 10.1073/pnas.2334417100.
RX   PUBMED; 14610277.
RA   Belyantseva I.A., Boger E.T., Friedman T.B.;
RT   "Myosin XVa localizes to the tips of inner ear sensory cell stereocilia and
RT   is essential for staircase formation of the hair bundle";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(24):13958-13963(2003).
XX
RN   [2]
RP   1-7953
RX   DOI; 10.1038/ncb1219.
RX   PUBMED; 15654330.
RA   Belyantseva I.A., Boger E.T., Naz S., Frolenkov G.I., Sellers J.R.,
RA   Ahmed Z.M., Griffith A.J., Friedman T.B.;
RT   "Myosin-XVa is required for tip localization of whirlin and differential
RT   elongation of hair-cell stereocilia";
RL   Nat. Cell Biol. 7(2):148-156(2005).
XX
RN   [3]
RP   1-7953
RA   Belyantseva I.A., Boger E.T., Friedman T.B.;
RT   ;
RL   Submitted (26-JUN-2003) to the INSDC.
RL   NIDCD, NIH, 5 Research Court, Rockville, MD 20850, USA
XX
DR   MD5; 92c163d263febb53bd390e8a1c2700c8.
DR   Ensembl-Gn; ENSMUSG00000042678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094135; mus_musculus.
DR   EuropePMC; PMC2989820; 20505086.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7953
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="P5"
FT                   /tissue_type="vestibule"
FT                   /db_xref="taxon:10090"
FT   CDS             89..7009
FT                   /codon_start=1
FT                   /product="myosin XVA isoform 2a"
FT                   /note="Myo15a"
FT                   /db_xref="GOA:Q9QZZ4"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZZ4"
FT                   /protein_id="AAP88403.1"
FT                   /translation="MHSIRNLPSMRSREQHREDGVEDMTQLEDLQETTVLANLKTRFER
FT                   NLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANLAFAKMLDAKQ
FT                   NQCVIISGESGSGKTEATKLILRCLAAMNQRRDVMQQIKILEATPLLEAFGNAKTVRND
FT                   NSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQ
FT                   AFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFRILASILH
FT                   LGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIREKIFTPL
FT                   TVESAVDARDAIAKVLYALLFGWLITRVNALVSPKQDTLSIAILDIYGFEDLSFNSFEQ
FT                   LCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLISLKPYGILRIL
FT                   DDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPLPEFTIKHYAGKVTYQVHKFLDKNH
FT                   DQVRQDVLDLFVHSRTRVVAHLFSSHAAQTAPPRLGKSSSITRLYKAHTVAAKFQQSLL
FT                   DLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEGFPVRLPF
FT                   QVFIDRYRCLVALKLNVPADGDMCVSLLSRLCTVTPDMYRVGISKLFLKEHLHQLLESM
FT                   RERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLARQRYQQMRQSLLKFR
FT                   SLVHTYVNRRRYLKELSKREVVPVRHLEVPAEVAGLLQAAAGLKLSSGPRVAVVRAPRL
FT                   QAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLTVPLKMPLTRLPVEHHAEAISVFKLI
FT                   LRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLANQVWRNPNAYNSKRGWLLL
FT                   AACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAMGSGAARTFPPTQLEWTAI
FT                   QEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGDILKHRGLADGWRGWTVAMKNGVQWA
FT                   ELAGHDYVLDLVSDLELLRDFPRQKSYFIVGAEGPLAGRGDTRGVFGNCWDSDEDTPTR
FT                   PQPQDHVAKMPDLDGYCSHKEDGTNGETEAQRWTSNRQAVDSIGESTVPPRELDGYLDS
FT                   LFDPVLACGDADLEKPTAIAYRMKGGGQPGGGGGSTSEDTSRRPPEPKLKPIPGLDAST
FT                   LALQQAFIHRQAVLLAREMTLQALALQQQPLSATSRPQLPERPLAPEARPKTVVGTGPP
FT                   AKPVLVRPTPQSWAPGSVAKAPKIPSKPVAVPILAQDWTAPESISASPELVRYSTLNSE
FT                   HFPQPTQQIRSIIKQYKQPPWAGHPEARRTDGGKVFRRPPDPHEEALMILKGQKTQLAV
FT                   VPGTQVSREAVAMVKPVTSAPRPCMGPTPVQPSRSLEPPEDPVQTQLHRLVNPNFYGYQ
FT                   DIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILHDTFSEACLRISEDERLQMKALFAQN
FT                   QLDTQRPLVTESVKRAAISMARDSWEIYFSRLFPAMGSVGTGVQILAVSHTGIKLLQMV
FT                   KGSKEASRRLRVLCAYSFADILFVTMPSQNMLEFNLSNEKLILFSARAQQVKTLVDTFI
FT                   LELKKDSDYVVAVRNFLSEDPELLSFHKGDIIHLQSLEPTRVGYSAGCVVRKKLVYLEE
FT                   LRRRGPDFGWRFGAVHGRVGRFPSELVQPAAAPDFLQLPAEPGRGRAAAVVAAVASAAA
FT                   AQEVGRRREGPPVRARSADSGEDSIALPPSTMLEFAQKYFRDPRRRPRDGLKLKSKEDR
FT                   ESKTLEDVLCFTKVPIQESLIELSDSNLNKMAVDMFVAVMRFMGDAPLKGQSELDVLCT
FT                   LLKLCGDHEVMRDECYCQIVKQITDNSSPKQDSCQRGWRLLYIMAAYYSCSEVFYPYLI
FT                   RFLQHVSWTPGLPFQGIAKACEQNLQKTLRFGGRLEFPSNMELRAMLAGRSSKRQLSLL
FT                   PGGLERHLKIKTCTVALDVIEGLCTEMALTRPEAFDEYVIFVVTNRGQHVCPLSCRAYI
FT                   LDVASEMEQVDGGYTLWFRRVLWDQPLKFENELYVTMHYNQVLPDYLKGLFSSVPARQP
FT                   TEQQLQQVSKLASLQHRAKDHFYLPSVREVQEYIPAQLYHTTAGDTWLNLVSQHRQQTQ
FT                   ALSPHQARAQFLGLLSAFPLFGSSFFFIQSCSNVLVPAPCILAVNHNGLNFLSTKTHEL
FT                   IVKIPLKEIQSTWTQKPTANSSYPYVEISLGDVAAQRTMQLQLEQGLELCRVVAVHVES
FT                   MLSAREERLTLPPSEITLL"
XX
SQ   Sequence 7953 BP; 1825 A; 2260 C; 2206 G; 1662 T; 0 other;
     agcctgagcc tcctttccat ctctgtggag gcagacatag gacccccaac aaacagcatg        60
     caggttggga gccagccaca ggacccagat gcactccata cgcaacctgc cttctatgcg       120
     gtcccgtgag cagcacaggg aagatggagt ggaggacatg acgcagctgg aagacctcca       180
     agagaccact gtgctagcca acctaaagac cagatttgag cgaaacctca tctataccta       240
     tattggcagt attctggtgt cggtgaaccc atatcgaatg tttgcaatct acgggcctga       300
     gcaggtgcag cagtacagtg ggcgtgccct aggagaaaat cccccgcacc tctttgcaat       360
     tgctaatctt gccttcgcca aaatgcttga tgccaaacag aaccagtgtg tcatcatcag       420
     tggggagagt ggctctggaa agactgaggc tacgaaactg attctgcgct gcctggctgc       480
     catgaaccag agacgggacg tcatgcagca gataaagatc ctggaggcaa cgcctctcct       540
     ggaggccttt ggtaatgcca aaactgtcag gaatgacaac tccagccgct ttgggaagtt       600
     tgtggaaatc tttctagaag ggggtgtgat ctgtggtgcc ataacctctc agtacctgct       660
     ggagaagtca aggattgtgt tccaggccaa aaatgaaaga aattatcata ttttctatga       720
     gctgctggct gggctccctg ctcaactaag acaggccttc agcctgcagg aggctgagac       780
     ctactactac ctgaaccagg gcgggaactg tgagatcgct ggaaagagtg acgcagatga       840
     cttccgccgt ctgctggctg cgatggaggt gcttggcttc accagtgagg accaggacag       900
     catcttccga atcctagcct ccatcttaca cctgggcaat gtctattttg agaaacatga       960
     gaccgatgcc caggaggtgg cctcggtggt gagcgcccgg gagatccagg ctgtggcaga      1020
     gctgcttcag gtctctcctg agggcctgca gaaggctatc accttcaaag tgactgagac      1080
     aattcgagag aagatcttca cacccctaac agtggagagt gccgtagatg ccagggacgc      1140
     catcgccaag gtcttgtatg cactgctgtt tggctggctc atcaccaggg tcaacgctct      1200
     ggtgtcccca aaacaagata cattgtccat cgccatcttg gacatatatg gctttgagga      1260
     cctgagcttc aacagctttg aacaactgtg catcaactat gccaacgaga accttcagta      1320
     cctgttcaac aagatcgtct tccaggagga gcaggaggag tacatccggg agcagatgga      1380
     ctggagagag attgcctttg ctgacaacca gccctgcatc aacctcatct ccctgaagcc      1440
     ctacggcatc ctgcgcatcc tggatgacca gtgctgcttt ccccaggcca cagaccacac      1500
     attcctgcag aagtgccact accaccatgg cgccaacccg ctctactcta agcctaagat      1560
     gccactgcca gagtttacca tcaagcacta tgcaggcaag gtcacctacc aggtgcacaa      1620
     gttcctggac aagaaccatg accaagtgcg ccaagacgtc ctggacttgt ttgtgcacag      1680
     ccgcacaagg gtggtagcac accttttctc cagccacgct gcgcagactg cccctccacg      1740
     cctgggcaag agcagctcca ttacccgtct ctacaaggct cacacggtgg cggccaagtt      1800
     ccagcagtcc ctcctggacc tggtggaaaa gatggagagg tgtaaccctt tgttcgtgcg      1860
     ctgcctgaag cccaaccata agaaggaacc tggtctcttt gagccagatg tgatgatggc      1920
     acagttacgc tattcagggg ttctggagac tgtgaggatc cgcaaggaag gctttccggt      1980
     gcggctaccc ttccaggtgt ttatcgacag gtaccggtgc ctggtggccc tcaagctcaa      2040
     cgtgccagca gatggggaca tgtgtgtgtc attgctgagc cggctatgca cggtcactcc      2100
     agacatgtac cgtgttggga ttagcaagct cttcctcaag gagcacctgc accagctact      2160
     ggagagcatg cgggagcgag tccagaaccg agctgccctc accctgcagc gctacctgcg      2220
     aggttttttc atccaacggc acttccggtc cttgcggcgg aagatcatcc tactgcagag      2280
     cagagcccgt ggttttctgg ccagacaacg ctaccagcag atgaggcaga gtctgctgaa      2340
     gttccgttcc ctggtgcaca cctacgtgaa ccgccgccgc tacctcaagg agctgagcaa      2400
     gcgtgaagtg gtcccagtga gacatctgga ggtgccagct gaggtggctg ggctcctgca      2460
     agccgcagca ggcctcaagc tgtccagtgg gccccgagtg gctgttgtcc gggctcctag      2520
     gctccaggct gagccgtgtg tcacacttcc ccttgacatc aacaactacc ccatggccaa      2580
     gttcattcga tgccacttca aggaaccctc ctttgggatg ctgacagtgc ccctgaagat      2640
     gcctctcaca cggctgcctg tggagcacca cgcagaagcc ataagtgtct ttaagctaat      2700
     cctgcgtttc atgggagacc cccacctgca tggcacccaa gagatgatct tggggaacta      2760
     cattgtgcac caggggctgg tggagccagc tctgagggac gagatcctag cccagctggc      2820
     caaccaggtg tggcgcaatc ccaatgccta caactccaag cggggctggt tgctgttggc      2880
     tgcctgtctc agtggctttg cgccttcccc gcaccttgac aagttcctcc tcaagtttgt      2940
     atctgattat ggacagaatg gcttccaggc tgtgtgccag catcgcctcc tgcaggcgat      3000
     gggctcaggg gctgcccgga cctttccccc aactcagctg gagtggactg ccattcagga      3060
     gaaggccagt atggctctag atgtgagctg cttcaatggt gaccagttct cctgtccggt      3120
     ccacacctgg agtacggggg aagcggtggc tggagacatc ctaaagcaca gggggctggc      3180
     tgatggttgg aggggctgga cagtggccat gaagaatgga gtccagtggg cagagctggc      3240
     tggacatgac tatgtgctgg acctggtatc agacctggaa ctgctcaggg acttcccacg      3300
     acagaaatct tacttcatag tgggtgcaga agggcctttg gctggcaggg gagacaccag      3360
     aggagtgttt gggaactgct gggactcaga cgaggacaca cccacaaggc cccagcccca      3420
     ggaccacgtg gccaagatgc ctgacttgga tgggtactgc agccacaaag aggatggtac      3480
     aaatggagaa actgaggccc agagatggac atcgaaccgc caagctgtgg acagcattgg      3540
     agagtccact gtgcccccca gggagctgga tggctacttg gacagtctct tcgaccctgt      3600
     gctggcctgt ggggatgcgg acctggagaa gccgacagcc atcgcctacc gcatgaaagg      3660
     tgggggccag ccaggtggag gtggtggcag tacttctgaa gatacctccc ggagaccccc      3720
     ggaacccaag ctcaagccca tcccaggcct ggatgcctcc acactggctc tgcagcaagc      3780
     cttcatccac aggcaggctg tgctactggc ccgggagatg accctgcagg ctttggcact      3840
     tcagcagcag cctctgagtg caacctcaag acctcagctc ccagagagac ccctagcacc      3900
     agaggcacgg ccgaagactg tagtaggcac tggcccccca gccaagcctg tgctggtgcg      3960
     tccgactcca cagtcgtggg ctccgggctc tgtggcaaag gccccgaaga tacctagcaa      4020
     gcccgtggct gtcccaatcc tagctcaaga ttggactgct ccagaatcca tttcggcttc      4080
     ccctgagctg gttcggtatt ccacactcaa ctcagagcac ttcccacaac ccacacagca      4140
     gatcagaagc atcatcaagc aatacaaaca gccaccctgg gcaggacacc ctgaggcccg      4200
     caggacggat ggtggaaagg tcttcaggag gccacctgac ccccatgagg aggccctaat      4260
     gattctgaag ggacagaaga ctcaactagc agtagtgcct ggcactcagg tgtccagaga      4320
     ggctgtggcc atggtgaagc cggtgaccag tgctccaagg ccatgcatgg ggcccactcc      4380
     agtgcagcct tcaaggtcgc tggagcctcc agaggatcct gtgcagacac agctgcaccg      4440
     cctagtcaac cccaacttct atggctacca ggacatcccc tggcggatct tcctgcgcaa      4500
     ggaggtattt taccccaagg acaactacag tcaccctgtg cagctagacc tcctgttccg      4560
     gcagatcctg catgacacat tctccgaggc ttgcctgcgc atatctgagg atgagcggct      4620
     gcagatgaag gctctgtttg cccagaacca gctggacaca cagcgacctc tggtaacaga      4680
     aagtgtgaag cgggccgcca tcagcatggc ccgagacagc tgggagatct acttctctcg      4740
     cctcttcccg gcaatgggca gtgttggcac cggcgtgcag atcctagctg tgtctcacac      4800
     tggcatcaag ctcctgcaga tggtcaaggg cagcaaggag gccagcaggc ggctccgcgt      4860
     cctgtgtgca tacagctttg cagacatcct gtttgtaacc atgccatctc agaacatgct      4920
     agagttcaat ctgtccaacg agaagctcat cctcttctca gcccgggcgc agcaggtcaa      4980
     gaccctagta gacaccttca ttctggaact gaagaaggat tctgattatg ttgtggcagt      5040
     gaggaacttc ctgtctgaag accccgagct gctgtccttc cacaagggtg acatcatcca      5100
     cctgcagagc ctggaaccaa ctagagtggg ctacagcgcc ggttgtgtag tccgcaagaa      5160
     actggtgtac ctggaggagc tgaggcggag aggccctgac tttggctgga ggttcggggc      5220
     cgtccacggg cgcgtaggac gttttccttc agagctcgtg cagcccgcag ctgctccaga      5280
     cttcttgcag ctcccggcag agccagggcg gggccgggct gccgcggtgg tcgccgctgt      5340
     ggcctctgca gcagccgcac aggaggtggg gcgccggaga gagggtcccc cagtcagggc      5400
     gcgttccgct gacagcggag aggattccat agcgctccca ccgagcacaa tgctcgaatt      5460
     tgcccagaag tatttccgag accctcggag gcgtccccgg gatggcctca agctgaagtc      5520
     taaggaggat cgggagtcca aaactctgga ggacgtgctt tgcttcacta aggtcccgat      5580
     ccaggaatcc ctcattgaac tcagtgacag caatctcaac aagatggcgg ttgacatgtt      5640
     tgtagctgtg atgaggttca tgggagatgc cccactgaag ggccagagcg aactggatgt      5700
     tctctgcacc cttctgaagc tttgtggaga ccatgaggtc atgagagatg aatgctactg      5760
     ccagattgtg aagcagatca cagacaacag cagccctaag caggacagct gtcagcgagg      5820
     ctggaggctg ctttacatca tggctgccta ctatagttgc tctgaggtct tctatccata      5880
     cctcattcgc ttcctccaac atgtgagctg gactcctggc ctgcccttcc aagggattgc      5940
     caaggcctgt gaacagaacc tgcagaagac cttgcgtttt ggaggccgcc tggagttccc      6000
     cagcaatatg gagctccgtg ctatgttggc aggccgcagt tccaagaggc agctctctct      6060
     tcttccagga ggccttgaac gccatctgaa aatcaaaacg tgcacggtgg ccctggatgt      6120
     catagagggg ctctgtaccg agatggccct gacacgccct gaagcctttg atgagtatgt      6180
     catttttgtg gtcaccaacc gaggccagca cgtgtgtcca ctgagctgcc gggcctacat      6240
     actggatgtg gcctcagaga tggagcaggt ggacgggggc tacacactct ggttccggcg      6300
     ggtgctttgg gatcagccac tgaagtttga gaatgagctg tatgtgacca tgcactacaa      6360
     tcaggttctg cctgactacc tgaagggcct ctttagcagt gtgccggcca ggcagcccac      6420
     agagcaacaa ctacagcagg tgtccaagtt ggcttcactg cagcaccgag ccaaggacca      6480
     cttctacctg cccagtgtgc gtgaagtcca agagtacatc ccagcccagc tctaccacac      6540
     cacggccggt gacacctggc tcaacctggt tagccaacac aggcagcaga ctcaggcgct      6600
     cagtccccac caggcccgcg ctcagttcct gggcctcctc agtgccttcc ccttgtttgg      6660
     ctcctccttc ttcttcatcc agagctgcag caatgtcttg gtgccagccc cctgtatcct      6720
     cgctgtcaac cataacggcc tcaacttcct cagcaccaag acccatgagt tgattgtgaa      6780
     gattcccctg aaggagatcc agtccacgtg gactcagaag cccacggcca attccagtta      6840
     cccgtatgtg gagatctccc tgggggatgt ggcagcccag cggaccatgc agctccagct      6900
     ggagcagggt ctggagctgt gtcgcgtggt ggctgtgcat gtggagtcca tgctcagcgc      6960
     ccgggaggag cggctcacac tgcctcccag cgagatcacc ctcttgtgac gtggcctacc      7020
     ttttcactgc ttcccgccag aagatttgct ccatgccctg agggtagatg ctcagcctct      7080
     ccagaccaag tgactcttgg ggtgctgggg agatgactca acagttaaga acattggctg      7140
     gtgaaaaaaa gaacattggc tgtttttcca gggacctggg ttcaattcct agtatccaca      7200
     taacagctca caaccatttg taactccagt tctatgatgt tgtccatggg taccaggtac      7260
     acatgtgatg cagacatatg tgcaggcaaa atacctagac aagagccaga accttggagg      7320
     agaccaaagg agacaggagg aaaaactcaa gaacccaaga ggaccaatct ggagctggga      7380
     tggagttacg ggtgcagcca aggcttactt agcagaagtg gtttttaaaa gctggaccac      7440
     agggcctcca gaaggcagag cctgccttga caactgccct tgacagggaa gccccacact      7500
     agtagtttag atgttttggg ggctgcctct ggtttcttgg ggcttgatac tcagatctgc      7560
     tccggcgtca cactccagcc ttccgcatgt ccttgccagg tgccctcagc tcagacctag      7620
     gacccttagt catttcttca caagtatttc tggtctgtcc tccgtgctga cagattgagt      7680
     cagaatgact ttaaattcaa aatcaactca ggctacagag caagaccctg cctgagggga      7740
     ggggtgctgg ggagatgact caacagttaa gaacattggc tggtgaaaaa aagaacattg      7800
     gctgtttttc cagggacctg ggttcaattc ctagcatcca cataacagct cacaaccatt      7860
     tgtaactcca gttctatgat gttgtccatg ggtaccaggt acacatgtga tgcagacata      7920
     tgtgcaggca aaatacccat atccataaat aaa                                   7953
//


spacer
spacer