spacer

EBI Dbfetch

ID   AY331132; SV 1; linear; mRNA; STD; MUS; 11715 BP.
XX
AC   AY331132;
XX
DT   21-JUL-2003 (Rel. 76, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus myosin XVA isoform 1a mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-11715
RX   DOI; 10.1073/pnas.2334417100.
RX   PUBMED; 14610277.
RA   Belyantseva I.A., Boger E.T., Friedman T.B.;
RT   "Myosin XVa localizes to the tips of inner ear sensory cell stereocilia and
RT   is essential for staircase formation of the hair bundle";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(24):13958-13963(2003).
XX
RN   [2]
RP   1-11715
RA   Belyantseva I.A., Boger E.T., Friedman T.B.;
RT   ;
RL   Submitted (26-JUN-2003) to the INSDC.
RL   NIDCD, NIH, 5 Research Court, Rockville, MD 20850, USA
XX
DR   MD5; 7a06f9ddf7c5f596fb7c0483f7bad6c8.
DR   Ensembl-Gn; ENSMUSG00000042678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094135; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11715
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /dev_stage="P5"
FT                   /tissue_type="vestibule"
FT                   /db_xref="taxon:10090"
FT   CDS             290..10771
FT                   /codon_start=1
FT                   /product="myosin XVA isoform 1a"
FT                   /note="Myo15a"
FT                   /db_xref="GOA:Q9QZZ4"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZZ4"
FT                   /protein_id="AAP88402.1"
FT                   /translation="MADEEKKAKKGKKGKKAPEPEKPKRSLKGTSRLFMGFRDRTPKIS
FT                   KKGQFRSASAFFWGLHTGPQKTKRKKKARTVLKSTSKLMTQMRVGKKKRAMKGKKPSFM
FT                   VIRFPGRRGYGRLRPRAQSLSKASTAINWLTKKFLLKKAEESGSEQATVDAWLQRSSSR
FT                   VGSRKLPFPSGAEILRHGGRLRRFPRSHSIYSSGEPVGFLPFEDEAPFRHAGSRKSLYG
FT                   LEGFQDLGEYYDYHREGDDYYDQQSLYHYEEQEPYLAEFGGYSPAWPPYDDYGYPPGDP
FT                   YNYYHPDYYGDTLYPGYAYGYGYGYDDFEPPYAPPSGYSSPYSYHDSFESEAYPYSYYL
FT                   DPYATHHMPYPPYDFPYDTPYDIPYFDPYGVPYAEGVYGGGAEAIYPPGMPYVYPEEPA
FT                   FMYPWVPPPIMSPHNPYAHPMDDIAELEEPEETGEERQSTSFRLPSAAFFEQQGMDKPA
FT                   RSKLSLIRKFRLFPRPQVKLFGKEKLEVPLPPSLDIPLPLGDAEGEEEEEEMPPVPTMP
FT                   YTHPYWSFLTPRQRNLQRALSAFGARQGLGFGPEFGHPTPRPATSLARFLKKTLSEKKP
FT                   IPRLRGSQKARGGRPPVREAAYKRFGYKLAGMDPDRPNTPIVLRRSQPQARNNNNSHGP
FT                   PSPRPAPRALTHWSALISPPMPAPSPSPASPLTPPFSPTFSRPPRLASPYGSLRQHPPP
FT                   WAAPAHVPFPPQANWWGFAEPPGTSPEVAPDLLAFPVPRPSFRASRSRSRRAAYGFPSP
FT                   SLIGSRRRPHLPSPQPSLRSLPGQGYHSPLGPLSPQLSLRRGPFQPPFPPPPRRPQSLR
FT                   EAFSLRRASGRLGPPRSPVLGSPRPPSPPPLLKHGPRHRSLNLPSRLPRTWRRLSEPPT
FT                   RAVKPWVHRAYPPPPSAGPWGASTGALEQQENQREAEDSETPWTVPPLAPSWDVDMPPT
FT                   QRPPSPWPEGIGSLRGFSRPPPVPENPLLEHTSPSCEPQSEDRVSNLTGIFLGQHHDPG
FT                   PGQLTKSADPSLEKPEEVVTLGDPQPPAEPEALNPTPPNKNVVSERKVLRLSASYPLVT
FT                   CKQARATWPQWHRWKTVSRTPAPLAPTRAPGPLLKAGEQPRAEPGRFAVVMPQVRGVSS
FT                   FRPKGPAPVQPPEHPDQDPEQGPAPQACSLRWPCLWPPTDAHCLWSRIRTYSSQSHLRG
FT                   HGGDCHKSLWKKTRPQSWQNKMHSIRNLPSMRSREQHREDGVEDMTQLEDLQETTVLAN
FT                   LKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGENPPHLFAIANLAFA
FT                   KMLDAKQNQCVIISGESGSGKTEATKLILRCLAAMNQRRDVMQQIKILEATPLLEAFGN
FT                   AKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNERNYHIFYELLAG
FT                   LPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLGFTSEDQDSIFR
FT                   ILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQKAITFKVTETIR
FT                   EKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVNALVSPKQDTLSIAILDIYGFEDL
FT                   SFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADNQPCINLISLKP
FT                   YGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPLPEFTIKHYAGKVTYQVH
FT                   KFLDKNHDQVRQDVLDLFVHSRTRVVAHLFSSHAAQTAPPRLGKSSSITRLYKAHTVAA
FT                   KFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSGVLETVRIRKEG
FT                   FPVRLPFQVFIDRYRCLVALKLNVPADGDMCVSLLSRLCTVTPDMYRVGISKLFLKEHL
FT                   HQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARGFLARQRYQQMR
FT                   QSLLKFRSLVHTYVNRRRYLKELSKREVVPVRHLEVPAEVAGLLQAAAGLKLSSGPRVA
FT                   VVRAPRLQAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLTVPLKMPLTRLPVEHHAEA
FT                   ISVFKLILRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLANQVWRNPNAYNS
FT                   KRGWLLLAACLSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAMGSGAARTFPPT
FT                   QLEWTAIQEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGDILKHRGLADGWRGWTVAM
FT                   KNGVQWAELAGHDYVLDLVSDLELLRDFPRQKSYFIVGAEGPLAGRGDTRGVFGNCWDS
FT                   DEDTPTRPQPQDHVAKMPDLDGYCSHKEDGTNGETEAQRWTSNRQAVDSIGESTVPPRE
FT                   LDGYLDSLFDPVLACGDADLEKPTAIAYRMKGGGQPGGGGGSTSEDTSRRPPEPKLKPI
FT                   PGLDASTLALQQAFIHRQAVLLAREMTLQALALQQQPLSATSRPQLPERPLAPEARPKT
FT                   VVGTGPPAKPVLVRPTPQSWAPGSVAKAPKIPSKPVAVPILAQDWTAPESISASPELVR
FT                   YSTLNSEHFPQPTQQIRSIIKQYKQPPWAGHPEARRTDGGKVFRRPPDPHEEALMILKG
FT                   QKTQLAVVPGTQVSREAVAMVKPVTSAPRPCMGPTPVQPSRSLEPPEDPVQTQLHRLVN
FT                   PNFYGYQDIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILHDTFSEACLRISEDERLQM
FT                   KALFAQNQLDTQRPLVTESVKRAAISMARDSWEIYFSRLFPAMGSVGTGVQILAVSHTG
FT                   IKLLQMVKGSKEASRRLRVLCAYSFADILFVTMPSQNMLEFNLSNEKLILFSARAQQVK
FT                   TLVDTFILELKKDSDYVVAVRNFLSEDPELLSFHKGDIIHLQSLEPTRVGYSAGCVVRK
FT                   KLVYLEELRRRGPDFGWRFGAVHGRVGRFPSELVQPAAAPDFLQLPAEPGRGRAAAVVA
FT                   AVASAAAAQEVGRRREGPPVRARSADSGEDSIALPPSTMLEFAQKYFRDPRRRPRDGLK
FT                   LKSKEDRESKTLEDVLCFTKVPIQESLIELSDSNLNKMAVDMFVAVMRFMGDAPLKGQS
FT                   ELDVLCTLLKLCGDHEVMRDECYCQIVKQITDNSSPKQDSCQRGWRLLYIMAAYYSCSE
FT                   VFYPYLIRFLQHVSWTPGLPFQGIAKACEQNLQKTLRFGGRLEFPSNMELRAMLAGRSS
FT                   KRQLSLLPGGLERHLKIKTCTVALDVIEGLCTEMALTRPEAFDEYVIFVVTNRGQHVCP
FT                   LSCRAYILDVASEMEQVDGGYTLWFRRVLWDQPLKFENELYVTMHYNQVLPDYLKGLFS
FT                   SVPARQPTEQQLQQVSKLASLQHRAKDHFYLPSVREVQEYIPAQLYHTTAGDTWLNLVS
FT                   QHRQQTQALSPHQARAQFLGLLSAFPLFGSSFFFIQSCSNVLVPAPCILAVNHNGLNFL
FT                   STKTHELIVKIPLKEIQSTWTQKPTANSSYPYVEISLGDVAAQRTMQLQLEQGLELCRV
FT                   VAVHVESMLSAREERLTLPPSEITLL"
XX
SQ   Sequence 11715 BP; 2653 A; 3564 C; 3155 G; 2343 T; 0 other;
     agcctgagcc tcctttccat ctctgtggag gcagacatag gacccccaac aaacagcatg        60
     caggttggga gccagccaca ggacccaggt gaaacccaag gctggtctag agaatgaatt       120
     atggatcctc gctgtccgtg ccacccagct agtcccagcg gctcagacac tgaggagaga       180
     ctgtaggttc agctacaagc aaaaagacct agctggtctc caagcagtgt ctccaagtcc       240
     ctgaacctgt gacacctgcc ccaggcatca tcaggcacag agggccacca tggcggatga       300
     ggagaagaaa gcgaagaaag ggaagaaggg gaagaaggcc ccagagcctg agaaacccaa       360
     acggagcctc aagggcacat ctcggctctt catgggcttc cgagaccgca cgcccaagat       420
     ctctaagaaa ggtcagttcc gaagtgcatc agccttcttc tggggcctcc acactggccc       480
     gcagaagacc aagcgcaaga agaaggcccg tactgttctc aaatccacat ccaaactcat       540
     gacgcagatg cgggtgggca aaaagaagcg ggcgatgaag ggaaagaagc cctcgttcat       600
     ggtgatccgc ttccctggac ggcgcggcta tggccgcttg aggcctcgtg cccagtcact       660
     tagcaaggca tccacagcta ttaactggct gaccaagaag ttcctcctca agaaggccga       720
     agagtcaggc agtgagcagg ccacagtgga cgcctggctc cagcgctcca gctcccgagt       780
     tggctcacgt aagctgccct tcccgtcggg tgctgagatc ctgcggcatg gaggccggct       840
     ccgcaggttc ccccgcagtc atagcatcta ctcctccgga gagcccgtgg gcttcctgcc       900
     ctttgaggac gaagccccat ttcggcacgc aggctcccgc aagtcattgt atgggctcga       960
     gggcttccag gacctgggtg aatattacga ctaccatcgg gaaggcgacg actactatga      1020
     ccagcagtcg ctataccact acgaggagca ggagccctac ttggctgagt tcggtgggta      1080
     tagcccggcc tggccaccct atgatgacta tgggtaccca cccggagacc cgtacaacta      1140
     ctaccaccct gactactacg gtgacaccct ctaccctggc tatgcctatg gctatggcta      1200
     cggctacgat gattttgagc ccccatatgc gcccccatca gggtattcat cgccttacag      1260
     ctaccatgac agctttgaga gtgaggccta cccatacagc tactacctgg acccctatgc      1320
     aactcaccac atgccctatc caccctatga ctttccatat gacactcctt acgacatacc      1380
     ctactttgat ccttatgggg ttccctatgc tgaaggtgtc tatggcggtg gggccgaggc      1440
     catctatccc cctgggatgc cctatgtcta tccagaagag ccagctttta tgtacccatg      1500
     ggtgccgcca cccataatgt cgccccacaa cccatatgcc caccccatgg acgacattgc      1560
     cgagctggag gagcctgagg aaacaggtga agaacgtcag agcacctcct tccgcctgcc      1620
     cagtgccgcc ttcttcgagc aacaaggtat ggacaaacca gccaggtcca aactatccct      1680
     catccggaag ttccgcctct tcccacggcc tcaggtgaag ctgtttggga aagagaagct      1740
     agaggtgccc ctgccaccct ccctcgacat tcctctgcct ttaggggatg cagagggtga      1800
     ggaagaggag gaggaaatgc ccccagtgcc cacgatgccc tacacccacc cttactggag      1860
     cttcctcaca ccgcgccagc gaaacctaca gcgcgccctg tcagcctttg gtgcccgcca      1920
     aggcctaggc tttggccctg agtttggcca cccaacgcca cgcccagcca cctcactggc      1980
     acggttcctc aaaaaaacac tgtcagaaaa gaagcccatt ccacggctca ggggcagcca      2040
     gaaggcccga ggagggcggc ccccagtgag ggaggcagcc tacaaacgct ttggctacaa      2100
     gctggccggc atggaccccg atcgacccaa cacgcccatt gtgctgagac gaagtcagcc      2160
     acaagctcgc aacaacaaca actcccacgg gccaccgtca cccaggcctg caccaagggc      2220
     actcacgcac tggagtgctc tcatctctcc tccaatgcct gcgccatctc ccagccccgc      2280
     ctctccattg accccaccct tctctccaac cttctcccgg cctccaaggc tagcttcccc      2340
     ctatggctcc ctccgccagc atccaccacc ctgggctgcc ccagctcatg tgccttttcc      2400
     accccaggca aattggtggg gctttgctga accccctgga acaagcccag aggttgcgcc      2460
     tgaccttctg gcctttcctg taccccggcc ctcgttcagg gcttcccgca gtcgcagtcg      2520
     gagggcagct tatggtttcc ccagcccttc cctgatagga tccaggagaa ggccccacct      2580
     gccctcaccc cagccctctc tgaggagcct tccaggtcag ggctaccact caccactggg      2640
     accgttgtct cctcagttgt ccctccgaag gggtcctttc cagccaccct tcccaccccc      2700
     tccacgcaga cctcagtcac tccgggaggc cttctctcta cgtagagcct ctgggcgcct      2760
     gggcccaccc cgctcaccag tgctaggttc tccccgacca ccctcaccac ccccactcct      2820
     gaaacacggc ccccggcacc ggtccctcaa cctgccctca cgccttccac ggacctggcg      2880
     gcgcctcagc gagcctccta cgcgggctgt gaaaccatgg gtacataggg cgtacccccc      2940
     accacccagt gccgggccct ggggggcatc cacgggggct ttggagcagc aagagaacca      3000
     acgtgaagca gaagactcag aaacaccgtg gacagttccc ccattggccc ccagctggga      3060
     tgtggatatg cctcccacac aacgcccacc ttctccgtgg ccagaaggta taggcagcct      3120
     tagaggcttc tccaggcccc ctcctgtgcc tgaaaatcca ttgcttgagc acacaagccc      3180
     ttcatgtgag ccacagtctg aggaccgagt ctctaattta actggtatct tcctgggcca      3240
     acaccatgac ccagggcctg ggcaactcac caagtcagcc gacccaagct tggagaagcc      3300
     tgaagaagtg gtcaccctag gggaccctca gccaccagct gagcctgagg ccctgaaccc      3360
     aacacctccc aacaaaaatg ttgtctcgga gaggaaggtt ttacgactca gcgcctcgta      3420
     cccactggtc acatgtaagc aggcaagggc aacatggcca caatggcacc gctggaagac      3480
     agtgtctaga actccagctc ccttggcccc caccagagcc ccagggccct tgctcaaggc      3540
     tggtgagcag ccccgggcag aacctgggcg gtttgcagtt gtcatgcctc aggtgcgtgg      3600
     ggtaagctcc ttccggccaa aagggcctgc tcctgtgcag cctccagagc atccagacca      3660
     agacccagag cagggcccag ccccccaagc ctgtagtcta cgctggccct gcctctggcc      3720
     accaacagat gctcactgtc tctggtcacg aattcgcacc tactcctctc aatcccacct      3780
     ccggggccat ggaggtgact gtcacaagag cctctggaaa aagactcgcc cccaaagctg      3840
     gcagaacaag atgcactcca tacgcaacct gccttctatg cggtcccgtg agcagcacag      3900
     ggaagatgga gtggaggaca tgacgcagct ggaagacctc caagagacca ctgtgctagc      3960
     caacctaaag accagatttg agcgaaacct catctatacc tatattggca gtattctggt      4020
     gtcggtgaac ccatatcgaa tgtttgcaat ctacgggcct gagcaggtgc agcagtacag      4080
     tgggcgtgcc ctaggagaaa atcccccgca cctctttgca attgctaatc ttgccttcgc      4140
     caaaatgctt gatgccaaac agaaccagtg tgtcatcatc agtggggaga gtggctctgg      4200
     aaagactgag gctacgaaac tgattctgcg ctgcctggct gccatgaacc agagacggga      4260
     cgtcatgcag cagataaaga tcctggaggc aacgcctctc ctggaggcct ttggtaatgc      4320
     caaaactgtc aggaatgaca actccagccg ctttgggaag tttgtggaaa tctttctaga      4380
     agggggtgtg atctgtggtg ccataacctc tcagtacctg ctggagaagt caaggattgt      4440
     gttccaggcc aaaaatgaaa gaaattatca tattttctat gagctgctgg ctgggctccc      4500
     tgctcaacta agacaggcct tcagcctgca ggaggctgag acctactact acctgaacca      4560
     gggcgggaac tgtgagatcg ctggaaagag tgacgcagat gacttccgcc gtctgctggc      4620
     tgcgatggag gtgcttggct tcaccagtga ggaccaggac agcatcttcc gaatcctagc      4680
     ctccatctta cacctgggca atgtctattt tgagaaacat gagaccgatg cccaggaggt      4740
     ggcctcggtg gtgagcgccc gggagatcca ggctgtggca gagctgcttc aggtctctcc      4800
     tgagggcctg cagaaggcta tcaccttcaa agtgactgag acaattcgag agaagatctt      4860
     cacaccccta acagtggaga gtgccgtaga tgccagggac gccatcgcca aggtcttgta      4920
     tgcactgctg tttggctggc tcatcaccag ggtcaacgct ctggtgtccc caaaacaaga      4980
     tacattgtcc atcgccatct tggacatata tggctttgag gacctgagct tcaacagctt      5040
     tgaacaactg tgcatcaact atgccaacga gaaccttcag tacctgttca acaagatcgt      5100
     cttccaggag gagcaggagg agtacatccg ggagcagatg gactggagag agattgcctt      5160
     tgctgacaac cagccctgca tcaacctcat ctccctgaag ccctacggca tcctgcgcat      5220
     cctggatgac cagtgctgct ttccccaggc cacagaccac acattcctgc agaagtgcca      5280
     ctaccaccat ggcgccaacc cgctctactc taagcctaag atgccactgc cagagtttac      5340
     catcaagcac tatgcaggca aggtcaccta ccaggtgcac aagttcctgg acaagaacca      5400
     tgaccaagtg cgccaagacg tcctggactt gtttgtgcac agccgcacaa gggtggtagc      5460
     acaccttttc tccagccacg ctgcgcagac tgcccctcca cgcctgggca agagcagctc      5520
     cattacccgt ctctacaagg ctcacacggt ggcggccaag ttccagcagt ccctcctgga      5580
     cctggtggaa aagatggaga ggtgtaaccc tttgttcgtg cgctgcctga agcccaacca      5640
     taagaaggaa cctggtctct ttgagccaga tgtgatgatg gcacagttac gctattcagg      5700
     ggttctggag actgtgagga tccgcaagga aggctttccg gtgcggctac ccttccaggt      5760
     gtttatcgac aggtaccggt gcctggtggc cctcaagctc aacgtgccag cagatgggga      5820
     catgtgtgtg tcattgctga gccggctatg cacggtcact ccagacatgt accgtgttgg      5880
     gattagcaag ctcttcctca aggagcacct gcaccagcta ctggagagca tgcgggagcg      5940
     agtccagaac cgagctgccc tcaccctgca gcgctacctg cgaggttttt tcatccaacg      6000
     gcacttccgg tccttgcggc ggaagatcat cctactgcag agcagagccc gtggttttct      6060
     ggccagacaa cgctaccagc agatgaggca gagtctgctg aagttccgtt ccctggtgca      6120
     cacctacgtg aaccgccgcc gctacctcaa ggagctgagc aagcgtgaag tggtcccagt      6180
     gagacatctg gaggtgccag ctgaggtggc tgggctcctg caagccgcag caggcctcaa      6240
     gctgtccagt gggccccgag tggctgttgt ccgggctcct aggctccagg ctgagccgtg      6300
     tgtcacactt ccccttgaca tcaacaacta ccccatggcc aagttcattc gatgccactt      6360
     caaggaaccc tcctttggga tgctgacagt gcccctgaag atgcctctca cacggctgcc      6420
     tgtggagcac cacgcagaag ccataagtgt ctttaagcta atcctgcgtt tcatgggaga      6480
     cccccacctg catggcaccc aagagatgat cttggggaac tacattgtgc accaggggct      6540
     ggtggagcca gctctgaggg acgagatcct agcccagctg gccaaccagg tgtggcgcaa      6600
     tcccaatgcc tacaactcca agcggggctg gttgctgttg gctgcctgtc tcagtggctt      6660
     tgcgccttcc ccgcaccttg acaagttcct cctcaagttt gtatctgatt atggacagaa      6720
     tggcttccag gctgtgtgcc agcatcgcct cctgcaggcg atgggctcag gggctgcccg      6780
     gacctttccc ccaactcagc tggagtggac tgccattcag gagaaggcca gtatggctct      6840
     agatgtgagc tgcttcaatg gtgaccagtt ctcctgtccg gtccacacct ggagtacggg      6900
     ggaagcggtg gctggagaca tcctaaagca cagggggctg gctgatggtt ggaggggctg      6960
     gacagtggcc atgaagaatg gagtccagtg ggcagagctg gctggacatg actatgtgct      7020
     ggacctggta tcagacctgg aactgctcag ggacttccca cgacagaaat cttacttcat      7080
     agtgggtgca gaagggcctt tggctggcag gggagacacc agaggagtgt ttgggaactg      7140
     ctgggactca gacgaggaca cacccacaag gccccagccc caggaccacg tggccaagat      7200
     gcctgacttg gatgggtact gcagccacaa agaggatggt acaaatggag aaactgaggc      7260
     ccagagatgg acatcgaacc gccaagctgt ggacagcatt ggagagtcca ctgtgccccc      7320
     cagggagctg gatggctact tggacagtct cttcgaccct gtgctggcct gtggggatgc      7380
     ggacctggag aagccgacag ccatcgccta ccgcatgaaa ggtgggggcc agccaggtgg      7440
     aggtggtggc agtacttctg aagatacctc ccggagaccc ccggaaccca agctcaagcc      7500
     catcccaggc ctggatgcct ccacactggc tctgcagcaa gccttcatcc acaggcaggc      7560
     tgtgctactg gcccgggaga tgaccctgca ggctttggca cttcagcagc agcctctgag      7620
     tgcaacctca agacctcagc tcccagagag acccctagca ccagaggcac ggccgaagac      7680
     tgtagtaggc actggccccc cagccaagcc tgtgctggtg cgtccgactc cacagtcgtg      7740
     ggctccgggc tctgtggcaa aggccccgaa gatacctagc aagcccgtgg ctgtcccaat      7800
     cctagctcaa gattggactg ctccagaatc catttcggct tcccctgagc tggttcggta      7860
     ttccacactc aactcagagc acttcccaca acccacacag cagatcagaa gcatcatcaa      7920
     gcaatacaaa cagccaccct gggcaggaca ccctgaggcc cgcaggacgg atggtggaaa      7980
     ggtcttcagg aggccacctg acccccatga ggaggcccta atgattctga agggacagaa      8040
     gactcaacta gcagtagtgc ctggcactca ggtgtccaga gaggctgtgg ccatggtgaa      8100
     gccggtgacc agtgctccaa ggccatgcat ggggcccact ccagtgcagc cttcaaggtc      8160
     gctggagcct ccagaggatc ctgtgcagac acagctgcac cgcctagtca accccaactt      8220
     ctatggctac caggacatcc cctggcggat cttcctgcgc aaggaggtat tttaccccaa      8280
     ggacaactac agtcaccctg tgcagctaga cctcctgttc cggcagatcc tgcatgacac      8340
     attctccgag gcttgcctgc gcatatctga ggatgagcgg ctgcagatga aggctctgtt      8400
     tgcccagaac cagctggaca cacagcgacc tctggtaaca gaaagtgtga agcgggccgc      8460
     catcagcatg gcccgagaca gctgggagat ctacttctct cgcctcttcc cggcaatggg      8520
     cagtgttggc accggcgtgc agatcctagc tgtgtctcac actggcatca agctcctgca      8580
     gatggtcaag ggcagcaagg aggccagcag gcggctccgc gtcctgtgtg catacagctt      8640
     tgcagacatc ctgtttgtaa ccatgccatc tcagaacatg ctagagttca atctgtccaa      8700
     cgagaagctc atcctcttct cagcccgggc gcagcaggtc aagaccctag tagacacctt      8760
     cattctggaa ctgaagaagg attctgatta tgttgtggca gtgaggaact tcctgtctga      8820
     agaccccgag ctgctgtcct tccacaaggg tgacatcatc cacctgcaga gcctggaacc      8880
     aactagagtg ggctacagcg ccggttgtgt agtccgcaag aaactggtgt acctggagga      8940
     gctgaggcgg agaggccctg actttggctg gaggttcggg gccgtccacg ggcgcgtagg      9000
     acgttttcct tcagagctcg tgcagcccgc agctgctcca gacttcttgc agctcccggc      9060
     agagccaggg cggggccggg ctgccgcggt ggtcgccgct gtggcctctg cagcagccgc      9120
     acaggaggtg gggcgccgga gagagggtcc cccagtcagg gcgcgttccg ctgacagcgg      9180
     agaggattcc atagcgctcc caccgagcac aatgctcgaa tttgcccaga agtatttccg      9240
     agaccctcgg aggcgtcccc gggatggcct caagctgaag tctaaggagg atcgggagtc      9300
     caaaactctg gaggacgtgc tttgcttcac taaggtcccg atccaggaat ccctcattga      9360
     actcagtgac agcaatctca acaagatggc ggttgacatg tttgtagctg tgatgaggtt      9420
     catgggagat gccccactga agggccagag cgaactggat gttctctgca cccttctgaa      9480
     gctttgtgga gaccatgagg tcatgagaga tgaatgctac tgccagattg tgaagcagat      9540
     cacagacaac agcagcccta agcaggacag ctgtcagcga ggctggaggc tgctttacat      9600
     catggctgcc tactatagtt gctctgaggt cttctatcca tacctcattc gcttcctcca      9660
     acatgtgagc tggactcctg gcctgccctt ccaagggatt gccaaggcct gtgaacagaa      9720
     cctgcagaag accttgcgtt ttggaggccg cctggagttc cccagcaata tggagctccg      9780
     tgctatgttg gcaggccgca gttccaagag gcagctctct cttcttccag gaggccttga      9840
     acgccatctg aaaatcaaaa cgtgcacggt ggccctggat gtcatagagg ggctctgtac      9900
     cgagatggcc ctgacacgcc ctgaagcctt tgatgagtat gtcatttttg tggtcaccaa      9960
     ccgaggccag cacgtgtgtc cactgagctg ccgggcctac atactggatg tggcctcaga     10020
     gatggagcag gtggacgggg gctacacact ctggttccgg cgggtgcttt gggatcagcc     10080
     actgaagttt gagaatgagc tgtatgtgac catgcactac aatcaggttc tgcctgacta     10140
     cctgaagggc ctctttagca gtgtgccggc caggcagccc acagagcaac aactacagca     10200
     ggtgtccaag ttggcttcac tgcagcaccg agccaaggac cacttctacc tgcccagtgt     10260
     gcgtgaagtc caagagtaca tcccagccca gctctaccac accacggccg gtgacacctg     10320
     gctcaacctg gttagccaac acaggcagca gactcaggcg ctcagtcccc accaggcccg     10380
     cgctcagttc ctgggcctcc tcagtgcctt ccccttgttt ggctcctcct tcttcttcat     10440
     ccagagctgc agcaatgtct tggtgccagc cccctgtatc ctcgctgtca accataacgg     10500
     cctcaacttc ctcagcacca agacccatga gttgattgtg aagattcccc tgaaggagat     10560
     ccagtccacg tggactcaga agcccacggc caattccagt tacccgtatg tggagatctc     10620
     cctgggggat gtggcagccc agcggaccat gcagctccag ctggagcagg gtctggagct     10680
     gtgtcgcgtg gtggctgtgc atgtggagtc catgctcagc gcccgggagg agcggctcac     10740
     actgcctccc agcgagatca ccctcttgtg acgtggccta ccttttcact gcttcccgcc     10800
     agaagatttg ctccatgccc tgagggtaga tgctcagcct ctccagacca agtgactctt     10860
     ggggtgctgg ggagatgact caacagttaa gaacattggc tggtgaaaaa aagaacattg     10920
     gctgtttttc cagggacctg ggttcaattc ctagtatcca cataacagct cacaaccatt     10980
     tgtaactcca gttctatgat gttgtccatg ggtaccaggt acacatgtga tgcagacata     11040
     tgtgcaggca aaatacctag acaagagcca gaaccttgga ggagaccaaa ggagacagga     11100
     ggaaaaactc aagaacccaa gaggaccaat ctggagctgg gatggagtta cgggtgcagc     11160
     caaggcttac ttagcagaag tggtttttaa aagctggacc acagggcctc cagaaggcag     11220
     agcctgcctt gacaactgcc cttgacaggg aagccccaca ctagtagttt agatgttttg     11280
     ggggctgcct ctggtttctt ggggcttgat actcagatct gctccggcgt cacactccag     11340
     ccttccgcat gtccttgcca ggtgccctca gctcagacct aggaccctta gtcatttctt     11400
     cacaagtatt tctggtctgt cctccgtgct gacagattga gtcagaatga ctttaaattc     11460
     aaaatcaact caggctacag agcaagaccc tgcctgaggg gaggggtgct ggggagatga     11520
     ctcaacagtt aagaacattg gctggtgaaa aaaagaacat tggctgtttt tccagggacc     11580
     tgggttcaat tcctagcatc cacataacag ctcacaacca tttgtaactc cagttctatg     11640
     atgttgtcca tgggtaccag gtacacatgt gatgcagaca tatgtgcagg caaaataccc     11700
     atatccataa ataaa                                                      11715
//


spacer
spacer