Dbfetch

ID   AY319516; SV 1; linear; mRNA; STD; MUS; 1011 BP.
XX
AC   AY319516;
XX
DT   30-AUG-2003 (Rel. 77, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus TARDBP S9 (TARDBP) mRNA, complete cds, alternative transcript.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1011
RA   Shen J.C.K., Wang I.-F., Wang H.-Y.;
RT   "Structural and Functional Aspects of the Eukaryoyic TDP gene Family";
RL   Unpublished.
XX
RN   [2]
RP   1-1011
RA   Wang I.-F., Wang H.-Y., Shen J.C.K.;
RT   ;
RL   Submitted (10-JUN-2003) to the INSDC.
RL   Institute of Molecular Biology, Academia Sinica, 128, Sec 2, Academia Rd.,
RL   Taipei 115, Taiwan
XX
DR   MD5; 5b692cf7a4f4e70926255e73fe636e10.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029129; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029094; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029042; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028831; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028244; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028793; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028942; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028906; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029032; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028933; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029591; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027964; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028324; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000095719; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172073; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069263; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0069327; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0069233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069244; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068913; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069740; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069381; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0068853; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0068989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0068889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0069076; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068906; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069924; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068877; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068077; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1011
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>1011
FT                   /gene="TARDBP"
FT                   /note="TDP-43; TDP43"
FT   CDS             1..915
FT                   /codon_start=1
FT                   /gene="TARDBP"
FT                   /product="TARDBP S9"
FT                   /note="TARDBP alternative transcript S9; short transcript
FT                   S9"
FT                   /db_xref="GOA:Q6VYI4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q6VYI4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP92691.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPG
FT                   GFGNQVHLISNVYGRSTSLKVVL"
XX
SQ   Sequence 1011 BP; 293 A; 194 C; 254 G; 270 T; 0 other;
     atgtctgaat atattcgggt aacagaagat gagaacgatg aacccattga aataccatca        60
     gaagacgatg ggacggtgtt gctgtccaca gttacagccc agtttccagg ggcatgcggc       120
     ctgcgctacc ggaatcccgt gtctcagtgt atgagaggag tccgactggt ggaaggaatt       180
     ctgcatgccc cagatgctgg ctggggcaat ctggtatatg ttgtcaacta tcccaaagat       240
     aacaaaagga aaatggatga gacagatgct tcctctgcag tgaaagtgaa aagagcagtc       300
     cagaaaacat ctgacctcat agtgttgggt ctcccctgga aaacaactga gcaggatctg       360
     aaagactatt tcagtacttt tggagaggtt cttatggttc aggtcaagaa agatcttaaa       420
     actggtcact cgaaagggtt tggctttgtt cgatttacag aatatgaaac ccaagtgaaa       480
     gtaatgtcac aacgacatat gatagatggg cgatggtgtg actgtaaact tcccaactct       540
     aagcaaagcc cagacgagcc tttgagaagc agaaaggtgt ttgttggacg ttgtacagag       600
     gacatgactg ctgaagagct tcagcagttt ttctgtcagt atggagaagt ggtagatgtc       660
     ttcattccca aaccattcag agcttttgcc ttcgtcacct ttgcagatga taaggttgcc       720
     cagtctcttt gtggagagga tttgatcatt aaaggaatca gcgtgcatat atccaatgct       780
     gaacctaagc ataatagcaa tagacagtta gaaagaagtg gaagatttgg tggtaatcca       840
     ggtggctttg ggaatcaggt tcatctcatt tcaaatgttt atggaagaag cacttcattg       900
     aaagtagtgc tgtaaatatt ctgccatagg aatacttctg tctacatgct ttctcatcca       960
     agaattcgtc atcacgctgc acaggctgcg tctttgacgg tgggtgttcc a               1011
//