spacer

EBI Dbfetch

ID   AY319513; SV 1; linear; mRNA; STD; MUS; 984 BP.
XX
AC   AY319513;
XX
DT   30-AUG-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus TARDBP S6 (TARDBP) mRNA, complete cds, alternative transcript.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-984
RA   Shen J.C.K., Wang I.-F., Wang H.-Y.;
RT   "Structural and Functional Aspects of the Eukaryoyic TDP gene Family";
RL   Unpublished.
XX
RN   [2]
RP   1-984
RA   Wang I.-F., Wang H.-Y., Shen J.C.K.;
RT   ;
RL   Submitted (10-JUN-2003) to the INSDC.
RL   Institute of Molecular Biology, Academia Sinica, 128, Sec 2, Academia Rd.,
RL   Taipei 115, Taiwan
XX
DR   MD5; cb11d0a203ae180ae4a96d5e687a2262.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105699; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..984
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..984
FT                   /gene="TARDBP"
FT                   /note="TDP-43; TDP43"
FT   CDS             1..888
FT                   /codon_start=1
FT                   /gene="TARDBP"
FT                   /product="TARDBP S6"
FT                   /note="TARDBP alternative transcript S6"
FT                   /db_xref="GOA:Q8R0B4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R0B4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAP92688.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGVHLI
FT                   SNVYGRSTSLKVVL"
XX
SQ   Sequence 984 BP; 287 A; 190 C; 244 G; 263 T; 0 other;
     atgtctgaat atattcgggt aacagaagat gagaacgatg aacccattga aataccatca        60
     gaagacgatg ggacggtgtt gctgtccaca gttacagccc agtttccagg ggcatgcggc       120
     ctgcgctacc ggaatcccgt gtctcagtgt atgagaggag tccgactggt ggaaggaatt       180
     ctgcatgccc cagatgctgg ctggggcaat ctggtatatg ttgtcaacta tcccaaagat       240
     aacaaaagga aaatggatga gacagatgct tcctctgcag tgaaagtgaa aagagcagtc       300
     cagaaaacat ctgacctcat agtgttgggt ctcccctgga aaacaactga gcaggatctg       360
     aaagactatt tcagtacttt tggagaggtt cttatggttc aggtcaagaa agatcttaaa       420
     actggtcact cgaaagggtt tggctttgtt cgatttacag aatatgaaac ccaagtgaaa       480
     gtaatgtcac aacgacatat gatagatggg cgatggtgtg actgtaaact tcccaactct       540
     aagcaaagcc cagacgagcc tttgagaagc agaaaggtgt ttgttggacg ttgtacagag       600
     gacatgactg ctgaagagct tcagcagttt ttctgtcagt atggagaagt ggtagatgtc       660
     ttcattccca aaccattcag agcttttgcc ttcgtcacct ttgcagatga taaggttgcc       720
     cagtctcttt gtggagagga tttgatcatt aaaggaatca gcgtgcatat atccaatgct       780
     gaacctaagc ataatagcaa tagacagtta gaaagaagtg gaagatttgg tgttcatctc       840
     atttcaaatg tttatggaag aagcacttca ttgaaagtag tgctgtaaat attctgccat       900
     aggaatactt ctgtctacat gctttctcat ccaagaattc gtcatcacgc tgcacaggct       960
     gcgtctttga cggtgggtgt tcca                                              984
//


spacer
spacer