spacer

EBI Dbfetch

ID   AY283604; SV 1; linear; genomic DNA; STD; HUM; 251 BP.
XX
AC   AY283604;
XX
DT   01-MAY-2004 (Rel. 79, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*11 new allele,
DE   exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-251
RA   Howson W., Coles R.J., Kukuruga D., Lee D., Li J.P., Snider D.;
RT   "Evolution in Real Time; Origin of a New DRB1 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-251
RA   Howson W., Coles R.J., Kukuruga D., Lee D., Li J.P., Snider D.;
RT   ;
RL   Submitted (24-APR-2003) to the INSDC.
RL   Immunogenetics and Transplantation Laboratory, London Health Sciences
RL   Centre, 339 Windermere Road, London, ON N6A 5A5, Canada
XX
DR   MD5; 3aab404af450aa38ed5c5593e594a9a1.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..251
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   gene            order(AY283603.1:<1..234,1..>251)
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT   mRNA            <1..>251
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>251
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q6WIG6"
FT                   /protein_id="AAQ18120.1"
FT                   /translation="PSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGL
FT                   IHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLT"
FT   exon            <1..>251
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /number=3
FT                   /note="similar to sequence in GenBank Accession Number
FT                   M22048"
XX
SQ   Sequence 251 BP; 59 A; 70 C; 71 G; 51 T; 0 other;
     tccttcaaag acccagcccc tgcagcacca caacctcctg gtctgttctg tgagtggttt        60
     ctatccaggc agcattgaag tcaggtggtt ccggaatggc caggaagaga agactggggt       120
     ggtgtccaca ggcctgatcc acaatggaga ctggaccttc cagaccctgg tgatgctgga       180
     aacagttcct cggagtggag aggtttacac ctgccaagtg gagcacccaa gcgtgacaag       240
     ccctctcaca g                                                            251
//


spacer
spacer