Dbfetch

ID   AH013152; SV 2; linear; genomic DNA; STD; HUM; 585 BP.
XX
AC   AH013152; AY283603-AY283604;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 6 MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*11
DE   new allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-585
RA   Howson W., Coles R.J., Kukuruga D., Lee D., Li J.P., Snider D.;
RT   "Evolution in Real Time; Origin of a New DRB1 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-585
RA   Howson W., Coles R.J., Kukuruga D., Lee D., Li J.P., Snider D.;
RT   ;
RL   Submitted (24-APR-2003) to the INSDC.
RL   Immunogenetics and Transplantation Laboratory, London Health Sciences
RL   Centre, 339 Windermere Road, London, ON N6A 5A5, Canada
XX
DR   MD5; a425633794442dff8c61b5fb3247ae51.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:33415223, gi:33415224, gi:33415222.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..585
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="lymphocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>585
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT   mRNA            <1..>234
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>234
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q6WIG7"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q6WIG7"
FT                   /protein_id="AAQ18119.1"
FT                   /translation="ECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVTELGRPDE
FT                   EYWNSQKDILEDERAAVDTYCRHNYGVVESFTV"
FT   exon            <1..>234
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /number=2
FT                   /note="similar to sequence in GenBank Accession Number
FT                   X86976"
FT   gap             235..334
FT                   /estimated_length=unknown
FT   mRNA            <335..>585
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /product="MHC class II antigen"
FT   CDS             <335..>585
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:Q6WIG6"
FT                   /protein_id="AAQ18120.1"
FT                   /translation="PSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGL
FT                   IHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLT"
FT   exon            <335..>585
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*11 new"
FT                   /number=3
FT                   /note="similar to sequence in GenBank Accession Number
FT                   M22048"
XX
SQ   Sequence 585 BP; 112 A; 122 C; 158 G; 93 T; 100 other;
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac        60
     caagaggagt acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       120
     gggcggcctg atgaggagta ctggaacagc cagaaggaca tcctggaaga cgagcgggcc       180
     gcggtggaca cctactgcag acacaactac ggggttgtgg agagcttcac agtgnnnnnn       240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnntccttc aaagacccag cccctgcagc       360
     accacaacct cctggtctgt tctgtgagtg gtttctatcc aggcagcatt gaagtcaggt       420
     ggttccggaa tggccaggaa gagaagactg gggtggtgtc cacaggcctg atccacaatg       480
     gagactggac cttccagacc ctggtgatgc tggaaacagt tcctcggagt ggagaggttt       540
     acacctgcca agtggagcac ccaagcgtga caagccctct cacag                       585
//