Dbfetch

ID   AY280365; SV 1; linear; mRNA; STD; MUS; 3620 BP.
XX
AC   AY280365;
XX
DT   03-JUN-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus transient receptor potential cation channel subfamily M member
DE   5 mRNA, complete cds; alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3620
RX   DOI; 10.1016/S0960-9822(03)00431-7.
RX   PUBMED; 12842017.
RA   Hofmann T., Chubanov V., Gudermann T., Montell C.;
RT   "TRPM5 is a voltage-modulated and Ca(2+)-activated monovalent selective
RT   cation channel";
RL   Curr Biol 13(13):1153-1158(2003).
XX
RN   [2]
RP   1-3620
RA   Chubanov V., Hofmann T., Gudermann T., Montell C.;
RT   ;
RL   Submitted (21-APR-2003) to the INSDC.
RL   Institut fuer Pharmakologie und Toxikologie, Philipps-Universitaet Marburg,
RL   Karl-von-Frisch-Strasse 1, Marburg D-35033, Germany
XX
DR   MD5; f5964858f199099c631addda6e1f55a6.
DR   Ensembl-Gn; ENSMUSG00000009246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150867; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3620
FT                   /organism="Mus musculus"
FT                   /strain="129/SvxC57BL"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             52..3054
FT                   /codon_start=1
FT                   /product="transient receptor potential cation channel
FT                   subfamily M member 5"
FT                   /note="cation channel TRPM5; MTR1; alternatively spliced"
FT                   /db_xref="GOA:Q9JJH7"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR029577"
FT                   /db_xref="MGI:MGI:1861718"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJH7"
FT                   /protein_id="AAP44477.1"
FT                   /translation="MQTTQSSCPGSPPDTEDGWEPILCRGEINFGGSGKKRGKFVKVPS
FT                   SVAPSVLFELLLTEWHLPAPNLVVSLVGEERPLAMKSWLRDVLRKGLVKAAQSTGAWIL
FT                   TSALHVGLARHVGQAVRDHSLASTSTKIRVVAIGMASLDRILHRQLLDGVHQKEDTPIH
FT                   YPADEGNIQGPLCPLDSNLSHFILVESGALGSGNDGLTELQLSLEKHISQQRTGYGGTS
FT                   CIQIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVSQPHLLVPQVA
FT                   EKQFREKFPSECFSWEAIVHWTELLQNIAAHPHLLTVYDFEQEGSEDLDTVILKALVKA
FT                   CKSHSQEAQDYLDELKLAVAWDRVDIAKSEIFNGDVEWKSCDLEEVMTDALVSNKPDFV
FT                   RLFVDSGADMAEFLTYGRLQQLYHSVSPKSLLFELLQRKHEEGRLTLAGLGAQQARELP
FT                   IGLPAFSLHEVSRVLKDFLHDACRGFYQDGRRMEERGPPKRPAGQKWLPDLSRKSEDPW
FT                   RDLFLWAVLQNRYEMATYFWAMGREGVAAALAACKIIKEMSHLEKEAEVARTMREAKYE
FT                   QLALDLFSECYGNSEDRAFALLVRRNHSWSRTTCLHLATEADAKAFFAHDGVQAFLTKI
FT                   WWGDMATGTPILRLLGAFTCPALIYTNLISFSEDAPQRMDLEDLQEPDSLDMEKSFLCS
FT                   RGGQLEKLTEAPRAPGDLGPQAAFLLTRWRKFWGAPVTVFLGNVVMYFAFLFLFTYVLL
FT                   VDFRPPPQGPSGSEVTLYFWVFTLVLEEIRQGFFTDEDTHLVKKFTLYVEDNWNKCDMV
FT                   AIFLFIVGVTCRMVPSVFEAGRTVLAIDFMVFTLRLIHIFAIHKQLGPKIIIVERMMKD
FT                   VFFFLFFLSVWLVAYGVTTQALLHPHDGRLEWIFRRVLYRPYLQIFGQIPLDEIDEARV
FT                   NCSLHPLLLESSASCPNLYANWLVILLLVTFLLVTNVLLMNLLIAMFRVLTETGPMSWY
FT                   FAAVSSGLDLQ"
XX
SQ   Sequence 3620 BP; 789 A; 998 C; 1034 G; 799 T; 0 other;
     aggcagtcct catgcagtcc aaggcactga ctgcctgact ggaaagccac catgcaaaca        60
     acccagagct cctgccccgg cagcccccca gatactgagg atggctggga gcccatccta       120
     tgcaggggag agatcaactt cggagggtct gggaagaagc gaggcaagtt tgtgaaggtg       180
     ccaagcagtg tggccccctc cgtgcttttt gaactcctgc tcaccgagtg gcacctgcca       240
     gcccccaacc tggtggtgtc cctggtgggt gaggaacgac ctttggctat gaagtcgtgg       300
     cttcgggatg tcctgcgcaa ggggctggtg aaagcagctc agagcacagg tgcctggatc       360
     ctgaccagtg ccctccacgt gggcctggcc cgccatgttg gacaagctgt acgtgatcac       420
     tctctggcta gcacatccac caagatccgt gtagtggcca tcggaatggc ctctctggat       480
     cgaatccttc accgtcaact tctagatggt gtccaccaaa aggaggatac tcccatccac       540
     tacccagcag atgagggcaa cattcaggga cccctctgcc ccctggacag caatctctcc       600
     cacttcatcc ttgtggagtc aggcgccctt gggagtggga acgacgggct gacagagctg       660
     cagctgagcc tggagaagca catctctcag cagaggacag gttatggggg caccagctgc       720
     atccagatac ctgtcctttg cctgttggtc aatggtgacc ccaacaccct agagaggatt       780
     tccagggcag tggagcaggc tgccccatgg ctgatcctgg caggttctgg tggcattgct       840
     gatgtactcg ctgccctggt gagccagcct catctcctgg tgccccaggt ggctgagaag       900
     cagttcagag agaaattccc cagcgagtgt ttctcttggg aagccattgt acactggaca       960
     gagctgttac agaacattgc tgcacacccc cacctgctca cagtatatga cttcgagcag      1020
     gagggttcgg aggacctgga cactgtcatc ctcaaggcac ttgtgaaagc ctgcaagagc      1080
     cacagccaag aagcccaaga ctacctagat gagctcaagt tagcagtggc ctgggatcgc      1140
     gtggacattg ccaagagtga aatcttcaat ggggacgtgg aatggaagtc ctgtgacttg      1200
     gaagaggtga tgacagatgc cctcgtgagc aacaagcctg actttgtccg cctctttgtg      1260
     gacagcggtg ctgacatggc cgagttcttg acctatgggc ggctgcagca gctttaccat      1320
     tctgtgtccc ccaagagcct cctctttgaa ctgctgcagc gtaagcatga ggagggtagg      1380
     ctgacactgg ccggcctggg tgcccagcag gctcgggagc tgcccattgg tctgcctgcc      1440
     ttctcactcc acgaggtctc ccgcgtactc aaagacttcc tgcatgacgc ctgccgtggc      1500
     ttctaccagg acgggcgcag gatggaggag agagggccac ctaagcggcc cgcaggccag      1560
     aagtggctgc cagacctcag taggaagagt gaagaccctt ggagggacct gttcctctgg      1620
     gctgtgctgc agaatcgtta tgagatggcc acatacttct gggccatggg ccgggagggt      1680
     gtggctgctg ctctggctgc ctgcaagatc ataaaggaaa tgtcccacct ggagaaagag      1740
     gcagaggtgg cccgcaccat gcgtgaggcc aagtatgagc agctggccct ggatcttttc      1800
     tcagagtgct acggcaacag tgaggaccgt gcctttgccc tgctggtgcg aaggaaccac      1860
     agctggagca ggaccacgtg cctgcacctg gccactgaag ctgatgccaa ggccttcttt      1920
     gcccatgacg gtgtgcaagc attcctgacc aagatctggt ggggagacat ggccacaggc      1980
     acacccatcc tacggcttct gggtgccttc acctgcccag ccctcatcta cacaaacctc      2040
     atctccttca gtgaggatgc cccgcagagg atggacctag aagatctgca ggagccagac      2100
     agcttggata tggaaaagag cttcctatgc agccggggtg gccaattgga gaagctaaca      2160
     gaggcaccaa gggctccagg cgatctaggc ccacaagctg ccttcctgct cacacggtgg      2220
     aggaagttct ggggcgctcc tgtgactgtg ttcctgggga atgtggtcat gtacttcgca      2280
     ttcctcttcc tgttcaccta tgtcctgctg gtggacttca ggccaccacc ccaggggccg      2340
     tctggatccg aggttaccct ctatttctgg gtgttcacac tggtgctgga ggaaatccga      2400
     cagggcttct tcacagatga ggacacgcac ctggtgaaga aattcactct gtatgtggaa      2460
     gacaactgga acaagtgtga catggtggcc atcttcctgt tcattgtggg agtcacctgt      2520
     agaatggtgc cctcggtgtt tgaggctggc aggaccgttc tggccattga cttcatggtg      2580
     ttcacacttc ggctcatcca catctttgct attcacaagc agttgggtcc taagatcatc      2640
     attgtagagc gaatgatgaa ggatgtcttc tttttcctct tcttcctgag cgtatggctt      2700
     gtggcctatg gtgtgaccac tcaggccctg ctgcatcccc atgatggccg tttggagtgg      2760
     attttccgcc gtgtgctata caggccttac ctgcagatct ttgggcaaat ccctctggat      2820
     gaaattgatg aggctcgtgt gaactgttct cttcaccctc tgctgctgga aagctcggct      2880
     tcctgcccta atctctatgc caactggctg gtcattctcc tgctggttac cttcctgctt      2940
     gtcactaatg tgctgctcat gaaccttctg atcgccatgt tcagggtgct gacagagaca      3000
     ggacccatgt cctggtattt tgctgctgtg tccagtgggc tggacctgca gtagagagcc      3060
     aacactacag ctacacattc caggtggtgc aaggcaatgc agacatgttc tggaagtttc      3120
     aacgctacca cctcatcgtt gaataccatg gaagaccagc tctggccccg cccttcatcc      3180
     tgctcagcca cctgagcctg gtgctcaagc aggtcttcag gaaggaagcc cagcataagc      3240
     gacaacatct ggagagagac ttgcctgacc ccttggacca gaagatcatt acctgggaaa      3300
     cggttcaaaa ggagaacttc ctgagtacca tggagaaacg gaggagggac agcgaggggg      3360
     aggtgctgag gaaaacggca cacagagtgg acttgattgc caaatacatc ggggggctga      3420
     gagagcaaga aaagaggatc aagtgtctgg aatcacaggc caactactgt atgctcctct      3480
     tgtcctctat gacggataca ctggctccag gaggcaccta ctcaagctct cagaactgtg      3540
     gttgcaggag tcagccagcc tctgctagag acagggagta cctagagtct ggcttgccac      3600
     cctctgacac ctgaaatgga                                                  3620
//